| Basic Information | |
|---|---|
| Taxon OID | 2038011002 Open in IMG/M |
| Scaffold ID | Coalbed1143_GAIGPUK01CK4BN Open in IMG/M |
| Source Dataset Name | Coalbed microbial communities from New Mexico, USA - 343 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Virginia Polytechnic Institute and State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 533 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From New Mexico, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | New Mexico | |||||||
| Coordinates | Lat. (o) | 36.728056 | Long. (o) | -108.220833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073159 | Metagenome / Metatranscriptome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Coalbed5_10234500 | F073159 | AGGAGG | MARRRKNAVRQGQGTMCNICGVNCGRGGPLKKHLKGAHDIDYDDYKKCFYDFDGKVKTILADKWDDSVSTSAGKTVITHVLVRRFIGDPGPRGVRRSG |
| ⦗Top⦘ |