| Basic Information | |
|---|---|
| Taxon OID | 2035918007 Open in IMG/M |
| Scaffold ID | Coalbed_GAIGPUK02JH6Z7 Open in IMG/M |
| Source Dataset Name | Coalbed microbial communities from New Mexico, USA - 340 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Virginia Polytechnic Institute and State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 555 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From New Mexico, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | New Mexico | |||||||
| Coordinates | Lat. (o) | 36.728056 | Long. (o) | -108.220833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F105430 | Metagenome / Metatranscriptome | 100 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Coalbed2_3721280 | F105430 | GAGG | MTSASSQQFFETFPPNVARAILEGRPLRIHAAKVSVVRDKTGAAFAIDTLPRDGRPKEWERTTQRSARS |
| ⦗Top⦘ |