NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FACENCT_F37DT1O01C51K6

Scaffold FACENCT_F37DT1O01C51K6


Overview

Basic Information
Taxon OID2035918005 Open in IMG/M
Scaffold IDFACENCT_F37DT1O01C51K6 Open in IMG/M
Source Dataset NameSoil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2+
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameNevada Desert Research Center
CoordinatesLat. (o)36.766667Long. (o)-115.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018165Metagenome / Metatranscriptome236Y
F059551Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
FACENCTE_10147890F059551N/AEELMGHLGEASGSIRAARRLLAEHASEDDPAHLRLLARLSEALDATEVASREARRQRGIG
FACENCTE_10147900F018165N/AKEGKGTVRDDQTVAEMANEVLMRQAKARADRSGEPIEEAMEAVLNTEAGKQLREFRDGPHGDEGVEEWQVGMARERARERVEQLGKHLEEPLEHPTHG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.