Scaffold FACENCT_F37DT1O01AK84C

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FACENCT_F37DT1O01AK84C

Scaffold FACENCT_F37DT1O01AK84C

Overview

Basic Information
Taxon OID	2035918005 Open in IMG/M
Scaffold ID	FACENCT_F37DT1O01AK84C Open in IMG/M
Source Dataset Name	Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2+
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	515
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location Name	Nevada Desert Research Center
Coordinates	Lat. (^o)	36.766667	Long. (^o)	-115.95	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059924	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
FACENCTE_5455920	F059924	GGAGG	MQATKYKDLVVLLILLDEVESRSRELAERYTELRAMAEAVSDATDLCDLAM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.