Scaffold FACENC_F56XM5W01CHY2T

Overview

Basic Information

• Taxon OID: 2035918004
• Scaffold ID: FACENC_F56XM5W01CHY2T
• Source Dataset Name: Soil microbial communities from sample at FACE Site 2 North Carolina CO2-
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 543
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location

• Location Name: Orange County, North Carolina
• Coordinates
  • Lat. (^o): 36.0
  • Long. (^o): -80.934
  • Depth (m): .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073985	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
FACENCA_2285120	F073985	GGAG	MRTLKLHFPDNALPTLDTFLKQTKEARVFRRAQAVREV