Metagenome / Metatranscriptome Family F073985

Basic Information
Family ID	F073985
Family Type	Metagenome / Metatranscriptome
Number of Sequences	120
Average Sequence Length	41 residues
Representative Sequence	MRTLKLHFPDNALPTLDTFLKQTKEARVFRRAQAVREV
Number of Associated Samples	97
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	95.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	92.50 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Most Common Taxonomy
Group	Bacteria (76.667 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.000 % of family members)
Environment Ontology (ENVO)	Unclassified (21.667 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (41.667 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF13358	DDE_3	2.50
PF01609	DDE_Tnp_1	2.50
PF00078	RVT_1	1.67
PF05168	HEPN	1.67
PF13551	HTH_29	1.67
PF13546	DDE_5	1.67
PF02452	PemK_toxin	1.67
PF00890	FAD_binding_2	0.83
PF02515	CoA_transf_3	0.83
PF12706	Lactamase_B_2	0.83
PF00589	Phage_integrase	0.83
PF07592	DDE_Tnp_ISAZ013	0.83
PF01408	GFO_IDH_MocA	0.83
PF07589	PEP-CTERM	0.83
PF14534	DUF4440	0.83
PF01526	DDE_Tnp_Tn3	0.83
PF12762	DDE_Tnp_IS1595	0.83
PF12760	Zn_Tnp_IS1595	0.83
PF00753	Lactamase_B	0.83
PF03972	MmgE_PrpD	0.83
PF01548	DEDD_Tnp_IS110	0.83
PF02416	TatA_B_E	0.83
PF00857	Isochorismatase	0.83
PF13453	zf-TFIIB	0.83
PF05685	Uma2	0.83
PF13580	SIS_2	0.83
PF13267	DUF4058	0.83
PF00891	Methyltransf_2	0.83
PF03458	Gly_transporter	0.83
PF10544	T5orf172	0.83
PF04307	YdjM	0.83
PF00496	SBP_bac_5	0.83
PF13359	DDE_Tnp_4	0.83
PF12680	SnoaL_2	0.83
PF13610	DDE_Tnp_IS240	0.83
PF13401	AAA_22	0.83
PF01656	CbiA	0.83
PF07992	Pyr_redox_2	0.83
PF04434	SWIM	0.83
PF13565	HTH_32	0.83
PF00665	rve	0.83
PF01494	FAD_binding_3	0.83
PF13518	HTH_28	0.83
PF01717	Meth_synt_2	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	2.50
COG3293	Transposase	Mobilome: prophages, transposons [X]	2.50
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	2.50
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	2.50
COG5421	Transposase	Mobilome: prophages, transposons [X]	2.50
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	2.50
COG1895	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	1.67
COG2250	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	1.67
COG2337	mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module	Defense mechanisms [V]	1.67
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.67
COG5431	Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain	General function prediction only [R]	0.83
COG4715	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	0.83
COG4644	Transposase and inactivated derivatives, TnpA family	Mobilome: prophages, transposons [X]	0.83
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	0.83
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.83
COG4279	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	0.83
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.83
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.83
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.83
COG2860	Uncharacterized membrane protein YeiH	Function unknown [S]	0.83
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.83
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.83
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.83
COG1988	Membrane-bound metal-dependent hydrolase YbcI, DUF457 family	General function prediction only [R]	0.83
COG1826	Twin-arginine protein secretion pathway components TatA and TatB	Intracellular trafficking, secretion, and vesicular transport [U]	0.83
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.83
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.83
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.83
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.83
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.83
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	76.67 %
Unclassified	root	N/A	23.33 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	76.67 %
Unclassified	root	N/A	23.33 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	76.67 %
Unclassified	root	N/A	23.33 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	31.67 %
Unclassified	root	N/A	23.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	8.33 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.67 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.67 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.67 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	1.67 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	0.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	30.83 %
Unclassified	root	N/A	23.33 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.50 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.67 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.67 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.67 %
Candidatus Omnitrophica	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica	1.67 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	0.83 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.83 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	30.83 %
Unclassified	root	N/A	23.33 %
unclassified Candidatus Omnitrophica	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica	1.67 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	1.67 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.67 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.83 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.83 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	0.83 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.83 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %

Name	Rank	Taxonomy	Distribution
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	29.17 %
Unclassified	root	N/A	23.33 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	1.67 %
Omnitrophica bacterium RIFOXYB12_FULL_50_7	species	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium RIFOXYB12_FULL_50_7	1.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.67 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.83 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.83 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.83 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.83 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	27.50 %
Unclassified	root	N/A	23.33 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	1.67 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	1.67 %
Omnitrophica bacterium RIFOXYB12_FULL_50_7	species	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium RIFOXYB12_FULL_50_7	1.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.67 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.83 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	0.83 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.83 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.83 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	27.50 %
Unclassified	root	N/A	23.33 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	1.67 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	1.67 %
Omnitrophica bacterium RIFOXYB12_FULL_50_7	species	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium RIFOXYB12_FULL_50_7	1.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.67 %
Smithella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella	0.83 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.83 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.83 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.83 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	27.50 %
Unclassified	root	N/A	23.33 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	1.67 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	1.67 %
Omnitrophica bacterium RIFOXYB12_FULL_50_7	species	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium RIFOXYB12_FULL_50_7	1.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.67 %
unclassified Smithella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella	0.83 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.83 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.83 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.83 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	27.50 %
Unclassified	root	N/A	23.33 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	1.67 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	1.67 %
Omnitrophica bacterium RIFOXYB12_FULL_50_7	species	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium RIFOXYB12_FULL_50_7	1.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.67 %
Smithella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp.	0.83 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.83 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.83 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.83 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2035918004\|FACENC_F56XM5W01CHY2T	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	543	Open in IMG/M
2170459014\|G1P06HT02HTIAF	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300005171\|Ga0066677_10241523	All Organisms → cellular organisms → Bacteria	1023	Open in IMG/M
3300005172\|Ga0066683_10893082	Not Available	509	Open in IMG/M
3300005179\|Ga0066684_10301059	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	1065	Open in IMG/M
3300005294\|Ga0065705_10231256	Not Available	1270	Open in IMG/M
3300005294\|Ga0065705_10351414	All Organisms → cellular organisms → Bacteria	943	Open in IMG/M
3300005294\|Ga0065705_10999610	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	547	Open in IMG/M
3300005332\|Ga0066388_103678338	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	783	Open in IMG/M
3300005332\|Ga0066388_105949784	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	616	Open in IMG/M
3300005332\|Ga0066388_107288513	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	556	Open in IMG/M
3300005332\|Ga0066388_107366999	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	552	Open in IMG/M
3300005445\|Ga0070708_100250281	All Organisms → cellular organisms → Bacteria	1665	Open in IMG/M
3300005467\|Ga0070706_101592835	Not Available	596	Open in IMG/M
3300005540\|Ga0066697_10715779	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300005554\|Ga0066661_10535687	All Organisms → cellular organisms → Bacteria	703	Open in IMG/M
3300005558\|Ga0066698_10076081	All Organisms → cellular organisms → Bacteria	2174	Open in IMG/M
3300005558\|Ga0066698_10519555	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	809	Open in IMG/M
3300005559\|Ga0066700_10398423	All Organisms → cellular organisms → Bacteria	971	Open in IMG/M
3300005562\|Ga0058697_10539765	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	601	Open in IMG/M
3300005713\|Ga0066905_101601842	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	596	Open in IMG/M
3300005713\|Ga0066905_101733109	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	575	Open in IMG/M
3300005719\|Ga0068861_101014734	All Organisms → cellular organisms → Bacteria	793	Open in IMG/M
3300005764\|Ga0066903_101781065	All Organisms → cellular organisms → Bacteria	1176	Open in IMG/M
3300006034\|Ga0066656_10117807	Not Available	1630	Open in IMG/M
3300006172\|Ga0075018_10019429	All Organisms → cellular organisms → Bacteria	2616	Open in IMG/M
3300006194\|Ga0075427_10056231	Not Available	684	Open in IMG/M
3300006844\|Ga0075428_100208835	All Organisms → cellular organisms → Bacteria	2110	Open in IMG/M
3300006845\|Ga0075421_101179011	All Organisms → cellular organisms → Bacteria → Proteobacteria	855	Open in IMG/M
3300006845\|Ga0075421_101183241	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	854	Open in IMG/M
3300006846\|Ga0075430_100844165	Not Available	755	Open in IMG/M
3300006847\|Ga0075431_100263016	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1750	Open in IMG/M
3300006847\|Ga0075431_100534502	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1161	Open in IMG/M
3300006847\|Ga0075431_100815489	All Organisms → cellular organisms → Bacteria	906	Open in IMG/M
3300006847\|Ga0075431_101732549	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300006871\|Ga0075434_100855190	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	925	Open in IMG/M
3300006871\|Ga0075434_102413494	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	528	Open in IMG/M
3300006880\|Ga0075429_100206816	Not Available	1720	Open in IMG/M
3300006969\|Ga0075419_10374526	All Organisms → cellular organisms → Bacteria	972	Open in IMG/M
3300007255\|Ga0099791_10316046	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300007258\|Ga0099793_10343564	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	729	Open in IMG/M
3300009012\|Ga0066710_103988415	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	552	Open in IMG/M
3300009090\|Ga0099827_10881451	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	775	Open in IMG/M
3300009090\|Ga0099827_11694901	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	551	Open in IMG/M
3300009090\|Ga0099827_11953309	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	510	Open in IMG/M
3300009094\|Ga0111539_12796350	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	565	Open in IMG/M
3300009100\|Ga0075418_12384069	All Organisms → cellular organisms → Bacteria → Proteobacteria	577	Open in IMG/M
3300009162\|Ga0075423_10160105	All Organisms → cellular organisms → Bacteria	2363	Open in IMG/M
3300009553\|Ga0105249_12434007	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	596	Open in IMG/M
3300010029\|Ga0105074_1068206	Not Available	644	Open in IMG/M
3300010046\|Ga0126384_10288024	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp.	1345	Open in IMG/M
3300010046\|Ga0126384_11756620	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	588	Open in IMG/M
3300010047\|Ga0126382_10013633	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4005	Open in IMG/M
3300010047\|Ga0126382_11973993	All Organisms → cellular organisms → Bacteria	554	Open in IMG/M
3300010359\|Ga0126376_11786259	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	652	Open in IMG/M
3300010360\|Ga0126372_10289491	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1432	Open in IMG/M
3300010360\|Ga0126372_10853935	All Organisms → cellular organisms → Bacteria	908	Open in IMG/M
3300010361\|Ga0126378_10165822	Not Available	2263	Open in IMG/M
3300010361\|Ga0126378_12239270	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	624	Open in IMG/M
3300010362\|Ga0126377_13005412	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	544	Open in IMG/M
3300010362\|Ga0126377_13124845	Not Available	535	Open in IMG/M
3300010366\|Ga0126379_10842093	All Organisms → cellular organisms → Bacteria	1018	Open in IMG/M
3300010366\|Ga0126379_13580629	Not Available	520	Open in IMG/M
3300012203\|Ga0137399_10916354	All Organisms → cellular organisms → Bacteria	738	Open in IMG/M
3300012205\|Ga0137362_10494340	Not Available	1058	Open in IMG/M
3300012205\|Ga0137362_11460672	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	570	Open in IMG/M
3300012210\|Ga0137378_11220907	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	668	Open in IMG/M
3300012349\|Ga0137387_10816398	All Organisms → cellular organisms → Bacteria → Proteobacteria	675	Open in IMG/M
3300012354\|Ga0137366_10831631	Not Available	655	Open in IMG/M
3300012356\|Ga0137371_11015867	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300012357\|Ga0137384_10899571	Not Available	713	Open in IMG/M
3300012357\|Ga0137384_11422991	Not Available	542	Open in IMG/M
3300012362\|Ga0137361_10207107	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1775	Open in IMG/M
3300012380\|Ga0134047_1113911	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300012390\|Ga0134054_1272577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	754	Open in IMG/M
3300012391\|Ga0134035_1039878	Not Available	630	Open in IMG/M
3300012917\|Ga0137395_11102176	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	562	Open in IMG/M
3300012925\|Ga0137419_10295979	Not Available	1236	Open in IMG/M
3300012930\|Ga0137407_11808802	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300012948\|Ga0126375_10517048	All Organisms → cellular organisms → Bacteria → Terrabacteria group	894	Open in IMG/M
3300012971\|Ga0126369_13024702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	550	Open in IMG/M
3300013306\|Ga0163162_13474977	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	501	Open in IMG/M
3300014150\|Ga0134081_10340289	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	548	Open in IMG/M
3300014267\|Ga0075313_1090377	Not Available	748	Open in IMG/M
3300014311\|Ga0075322_1136080	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300015371\|Ga0132258_11069890	All Organisms → cellular organisms → Bacteria	2039	Open in IMG/M
3300016319\|Ga0182033_10946126	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	764	Open in IMG/M
3300016319\|Ga0182033_11976205	Not Available	531	Open in IMG/M
3300016341\|Ga0182035_12163803	Not Available	504	Open in IMG/M
3300016357\|Ga0182032_10100513	All Organisms → cellular organisms → Bacteria	2040	Open in IMG/M
3300016371\|Ga0182034_10583655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	941	Open in IMG/M
3300016422\|Ga0182039_10306656	All Organisms → cellular organisms → Bacteria	1317	Open in IMG/M
3300017659\|Ga0134083_10290560	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	692	Open in IMG/M
3300017965\|Ga0190266_10569783	Not Available	678	Open in IMG/M
3300018054\|Ga0184621_10108771	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	985	Open in IMG/M
3300020067\|Ga0180109_1356486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	718	Open in IMG/M
3300025908\|Ga0207643_10431404	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	836	Open in IMG/M
3300025961\|Ga0207712_10139253	All Organisms → cellular organisms → Bacteria	1860	Open in IMG/M
3300026310\|Ga0209239_1104709	All Organisms → cellular organisms → Bacteria	1195	Open in IMG/M
3300027424\|Ga0209984_1061820	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300027876\|Ga0209974_10105589	Not Available	988	Open in IMG/M
3300027880\|Ga0209481_10463592	Not Available	653	Open in IMG/M
3300027909\|Ga0209382_10263555	All Organisms → cellular organisms → Bacteria	1953	Open in IMG/M
3300028608\|Ga0247819_10731820	Not Available	607	Open in IMG/M
3300030903\|Ga0308206_1114205	Not Available	618	Open in IMG/M
3300030905\|Ga0308200_1133049	Not Available	560	Open in IMG/M
3300031093\|Ga0308197_10346875	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	564	Open in IMG/M
3300031421\|Ga0308194_10120538	Not Available	778	Open in IMG/M
3300031546\|Ga0318538_10378787	All Organisms → cellular organisms → Bacteria	765	Open in IMG/M
3300031720\|Ga0307469_11780797	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	595	Open in IMG/M
3300031740\|Ga0307468_101806570	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	579	Open in IMG/M
3300031793\|Ga0318548_10398843	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium RIFOXYB12_FULL_50_7	674	Open in IMG/M
3300031910\|Ga0306923_10378204	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium RIFOXYB12_FULL_50_7	1613	Open in IMG/M
3300031912\|Ga0306921_11505940	All Organisms → cellular organisms → Bacteria → FCB group	735	Open in IMG/M
3300031941\|Ga0310912_10309918	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1223	Open in IMG/M
3300032059\|Ga0318533_10019916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4222	Open in IMG/M
3300032180\|Ga0307471_101747809	Not Available	775	Open in IMG/M
3300032205\|Ga0307472_101066282	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	762	Open in IMG/M
3300033550\|Ga0247829_10310481	All Organisms → cellular organisms → Bacteria	1282	Open in IMG/M
3300034661\|Ga0314782_187353	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	529	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	76.67%
Host-Associated	Host-Associated	22.50%
Engineered	Engineered	0.83%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	74.17%
Plants	Host-Associated → Plants	22.50%
Aquatic	Environmental → Aquatic	2.50%
Solid Waste	Engineered → Solid Waste	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	74.17%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.67%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.00%
Sediment	Environmental → Aquatic → Sediment	1.67%
Freshwater	Environmental → Aquatic → Freshwater	0.83%
Phylloplane	Host-Associated → Plants → Phylloplane	0.83%
Grass	Engineered → Solid Waste → Grass	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	63.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	16.67%
Loam	Environmental → Terrestrial → Soil → Loam	8.33%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.67%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.67%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.83%
Sand	Environmental → Terrestrial → Soil → Sand	0.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.83%
Composting	Engineered → Solid Waste → Grass → Composting	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	39.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	16.67%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	13.33%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.33%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.17%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.67%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.67%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.83%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.83%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.83%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	15.00%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	15.00%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	12.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.67%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.17%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.33%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.33%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	2.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.50%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.67%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.67%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.67%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.83%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.83%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.83%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.83%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2035918004	Soil microbial communities from sample at FACE Site 2 North Carolina CO2-	Environmental	Open in IMG/M
2170459014	Litter degradation PV2	Engineered	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006194	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010029	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012380	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012390	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012391	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014267	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1	Environmental	Open in IMG/M
3300014311	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300020067	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028608	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6	Environmental	Open in IMG/M
3300030903	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030905	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034661	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F073985

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FACENCA_2285120	2035918004	Soil	MRTLKLHFPDNALPTLDTFLKQTKEARVFRRAQAVREV
2PV_01390850	2170459014	Switchgrass, Maize And Mischanthus Litter	MRPLKSHFSDHALLTLDTLLKQTKEARVFRRAQAVRAVVAGQH
Ga0066677_102415231	3300005171	Soil	MRTRKLHFPEQALPTLDTFLKQTKEARIFRRAQAVREVVQGHRLQT
Ga0066683_108930821	3300005172	Soil	MRTLQLQFPDTALPTLETVLKETKEVRVFRRAQAVREVVK
Ga0066684_103010592	3300005179	Soil	MRTLKLHFPDEALPTLDTYLKQTKEARVFRRAQAVREVVKGQRLQ
Ga0065705_102312562	3300005294	Switchgrass Rhizosphere	MRTLKLHFPDEALPTLDTYLKQTKEARVFRRAQAVREVVKGQ
Ga0065705_103514141	3300005294	Switchgrass Rhizosphere	VESPRMRTLKLHFPEDALPTLDTFLKQTKEARVFRRAQAVRDVV
Ga0065705_109996102	3300005294	Switchgrass Rhizosphere	MRPLKSHFPAHALPTLEAVLKQPQEARGFRRAQAVREVVAGHHVNA
Ga0066388_1036783382	3300005332	Tropical Forest Soil	MRPLKSHFPDQALTTLDTLLKQTKEARVFRRAQAVREVVAGHHINA
Ga0066388_1059497841	3300005332	Tropical Forest Soil	MRTLKLRFPDDALPTLATFLKQTKEARVFRRAQAVREVVKGQRL
Ga0066388_1072885133	3300005332	Tropical Forest Soil	FIAGASHMRTLKAHFPDDALSTLDIFLKKTKETRVFRRAQAVRDVVQS*
Ga0066388_1073669992	3300005332	Tropical Forest Soil	MRTLKLRFPDDALPTLDTFLKQTKEARVFRRAQAVRDVVQ
Ga0070708_1002502811	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	VETPCMRTLKLHFPDDALPTLDTFVKQTKEARVFRRAQAVR
Ga0070706_1015928351	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MRPLKSHFPEHALPTLETVLKQTQEARVFRRAQAVREVVAG
Ga0066697_107157791	3300005540	Soil	MRTLQLHFSDNAFPTLNTFLQQTKEARVFRRAQAVRD
Ga0066661_105356871	3300005554	Soil	MRTLQLHFPDDALPTLDTVLKQTKEARVFRRAQAVRDVV
Ga0066698_100760811	3300005558	Soil	MRTLKLHFPDEALPTLDTFLKQTKEARVFRRAQAVREVVKGHRLQTV
Ga0066698_105195551	3300005558	Soil	MRTLQLHFPEDALPTLDTVLKQTKEARVFRRAQAVREVVKGQRL
Ga0066700_103984233	3300005559	Soil	MRPLKSHFPDHALTTLETMLKQTKEARVFRRAQAVHAVV
Ga0058697_105397652	3300005562	Agave	MRTLKLHFPDQALPTLDTCLKQTKEARIFRRAQAVR
Ga0066905_1016018422	3300005713	Tropical Forest Soil	MRTLKRHLPAQALPTWDTFLKQTKEARLFRRAQAVR
Ga0066905_1017331091	3300005713	Tropical Forest Soil	MRTLKLHFPDNALPTLDTFLKQTKEARVFRRAQAV
Ga0068861_1010147341	3300005719	Switchgrass Rhizosphere	MRPLKNHFRDDVLTTLEAVLKQTKEARVFRRAQAVREVVAGHHV
Ga0066903_1017810652	3300005764	Tropical Forest Soil	MRPLKSHFRDDALTTLDTVLKQTKEARVFRRAQAVREVV
Ga0066656_101178072	3300006034	Soil	MRTLKLHFPDDALPTLDTVLKPTKEARVFRRAQAVRE
Ga0075018_100194291	3300006172	Watersheds	MRPLKSHFPAHALTTLATVLKQTKEARVFRRAQAVHAVVAGQHVS
Ga0075427_100562311	3300006194	Populus Rhizosphere	MRPLKSHFRAHALTTLDTMLKQTKEARVFRRAQAVHAVVAG
Ga0075428_1002088353	3300006844	Populus Rhizosphere	MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRDVVKGQRL
Ga0075421_1011790111	3300006845	Populus Rhizosphere	MRTLKRHFPDNALPTLDTFLKQTKEARVFRRAQAVREVVKGHRLQ
Ga0075421_1011832412	3300006845	Populus Rhizosphere	MRTLKLHFPDDALSTLDTFLKQTKEARVFRRAQAV
Ga0075430_1008441651	3300006846	Populus Rhizosphere	MRPLKSHFPVHALTTLDTMLKQAKEARVFRRAQAVRAVVA
Ga0075431_1002630161	3300006847	Populus Rhizosphere	MRPLSSHFAHDALPTLDAFIKQTKKARVFRRAQAV
Ga0075431_1005345023	3300006847	Populus Rhizosphere	MRTLTVHLPDDALPTLDTFLKQTTEARICRRAQAVRDVVTG
Ga0075431_1008154891	3300006847	Populus Rhizosphere	MRTLKLHFPNDALPTLDTFVKQTREARVFRRAQAVREVVKGQRLQ
Ga0075431_1017325491	3300006847	Populus Rhizosphere	MRPLNSHFAPDALPTLDSFMKHSKEARVFRRAQAVRGVVAGQ
Ga0075434_1008551903	3300006871	Populus Rhizosphere	MRTLKLPFPDDVLPTLDTFLKQTKEARVFRRAQAVRHVV
Ga0075434_1024134941	3300006871	Populus Rhizosphere	MRTLKLHFPDDALTALDTLLKQTKEARVFRRAQAVREV
Ga0075429_1002068164	3300006880	Populus Rhizosphere	MRPLNSHFSHHALPTLDTLMKHSKEARVFRRAQAVREVVDGQTVKAV
Ga0075419_103745262	3300006969	Populus Rhizosphere	MRTLKLHFPDNALPTLDTFIKQTKEARVFRRAQAVRHVVKG
Ga0099791_103160461	3300007255	Vadose Zone Soil	MRTLTLHFPNDALPTLETFLKQTKAARVFRRAQAV
Ga0099793_103435641	3300007258	Vadose Zone Soil	MRTLKLHFSDNALPTLDTFLKQTKEARVFRRAQAVREVVKGQRL
Ga0066710_1039884152	3300009012	Grasslands Soil	MRTLQLHFPEDALPTLDTVLKQTKEARVFRRAQAVREVVKGT
Ga0099827_108814511	3300009090	Vadose Zone Soil	MIKAGKSPLMRTLKLHFPDDALPTIDTVLKQTKEARVFRRAQAVREVVK
Ga0099827_116949011	3300009090	Vadose Zone Soil	MRTLKLHFPDEALPTLDTYLKQTKEARVFRRAQAVREVVKGQRLQT
Ga0099827_119533092	3300009090	Vadose Zone Soil	MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRD
Ga0111539_127963502	3300009094	Populus Rhizosphere	MRTLKLHFPDEALPTLETCLKQTKEARVFRRAQAVREVVTGHRL
Ga0075418_123840691	3300009100	Populus Rhizosphere	MRTLKLHFPDQALPTLDTFLKQTKEARIFRRAQAVREV
Ga0075423_101601054	3300009162	Populus Rhizosphere	MRTLKLHFPAQALPTLDTFLKQTKEARIFRRAQAVRAVVQGHRLH
Ga0105249_124340071	3300009553	Switchgrass Rhizosphere	MRTLKLHFPEAALPTLDTFLKQTKEARVFRRAQAVRDV
Ga0105074_10682061	3300010029	Groundwater Sand	MRPLKSHFPVHALTTLDTMLKQAKEARVFRRAQAVRAVV
Ga0126384_102880243	3300010046	Tropical Forest Soil	MRTLHLHFPHDALSTLDTVLKQTKEARVFRRAQAVRE
Ga0126384_117566203	3300010046	Tropical Forest Soil	MRTLKLHFPDDALPTLENFLKQTKEARIFRRAQAVRDVVRGQRL
Ga0126382_100136335	3300010047	Tropical Forest Soil	MRTLKLHFPDDALPTLENFLKQTKEARIFRRAQAVREVVQGHRLQTV
Ga0126382_119739931	3300010047	Tropical Forest Soil	MHPLKSHFRDDALTTLETVLKQTKEARVFLRAQAGRAVVAGHHV
Ga0126376_117862591	3300010359	Tropical Forest Soil	MRTLKLHFPEDALPTLDTFLKQTKEARVFRRAQAVRDVV
Ga0126372_102894911	3300010360	Tropical Forest Soil	MRTLKLHFSDQALPTLETFLKQTKEARIFRRAQAVRAVVQGHRLPT
Ga0126372_108539351	3300010360	Tropical Forest Soil	MRTLKLHFPDNAPPTLDTFLKQTKEARVFRRAQAVRNVVKG
Ga0126378_101658221	3300010361	Tropical Forest Soil	MRPLKSHFDADALTTLETVLKQTKEARVFRRAQAV
Ga0126378_122392701	3300010361	Tropical Forest Soil	MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRHVVQGQRLQTVS
Ga0126377_130054121	3300010362	Tropical Forest Soil	MRTLKLHFAADALPTLETFLKRTKEARVFRRAQAVR
Ga0126377_131248451	3300010362	Tropical Forest Soil	MRPLKLPFPDDALPPLENFLQQTKEARIFRRAQAVREVVQG
Ga0126379_108420931	3300010366	Tropical Forest Soil	MRPLKSHFPEHALATLETVLKQTQEARGFRRAQAIREVVAG
Ga0126379_135806291	3300010366	Tropical Forest Soil	MRTLKLHVPDAALPPWDPFVQQTKEARVFRRAQAVRAVVQGQRLPTV
Ga0137399_109163542	3300012203	Vadose Zone Soil	MRTLKLHFPNDALPTLDTFLKQTKEARVFRRAQAVRE
Ga0137362_104943402	3300012205	Vadose Zone Soil	MRTLQLHFSDNALPTLNTFLQQTKEARVFRRAQAARDVVTG
Ga0137362_114606722	3300012205	Vadose Zone Soil	MRTLQLHFPEDALPTLDTVLKQTKEARVFRRAQAVRE
Ga0137378_112209071	3300012210	Vadose Zone Soil	MRTLKLHFPDDALSTLDTFVKQTREARVFRRAQAVREVVKGQR
Ga0137387_108163982	3300012349	Vadose Zone Soil	MRTLKLHFPDDALPTLETFLKQTREARVFRRAQAVR
Ga0137366_108316312	3300012354	Vadose Zone Soil	MRPLKSHFPAHALTTLETLLKQTKEARVFRRAQAVHAVVAGQHVS
Ga0137371_110158671	3300012356	Vadose Zone Soil	MRTLKLHFPDDALSTLDTFVKQTKEARVFRRAQAVRDVVKGRRMQNV
Ga0137384_108995711	3300012357	Vadose Zone Soil	MRPLKSHFPEHALPTLETVLKQTQEARVFRRAQAVRE
Ga0137384_114229911	3300012357	Vadose Zone Soil	MRTLQLHFPDDALPTLDTVLKQTKEARVFRRAQAV
Ga0137361_102071073	3300012362	Vadose Zone Soil	MRPLKSHFPDHALTTLDTMLKQTKEARVFRRAQAVHAVVAGQHVS
Ga0134047_11139112	3300012380	Grasslands Soil	MRTLKLHFPDEALPTLDTYLKQTTEARVFRRAQAV
Ga0134054_12725771	3300012390	Grasslands Soil	MRPLKSHFPEHALTTLDTLLKQTKEARVFRRAQAV
Ga0134035_10398781	3300012391	Grasslands Soil	MRPLKSHFPDHALTTLDTLLKQTKEARVFRRAQAVREVM
Ga0137395_111021761	3300012917	Vadose Zone Soil	MRTLKLHFPDDALPTLDTFVKQTREARVFRRAQAVRE
Ga0137419_102959791	3300012925	Vadose Zone Soil	MRPLKSHFPAHALPTVETVLKQPQEARGLRRAQAGRAVGAGPQVNTVSTTF
Ga0137407_118088022	3300012930	Vadose Zone Soil	MRTLQLHFPDDALPTLDTVLKQTKEARVFRRAQAVREVV
Ga0126375_105170482	3300012948	Tropical Forest Soil	MRPLTLPLPDEALPTLDTFLKKTKAARVFRRAQAGRDVVT
Ga0126369_130247022	3300012971	Tropical Forest Soil	METTRMRTLKLHFPDDALSTLDTCLKQTKEARVFRRAQA
Ga0163162_134749771	3300013306	Switchgrass Rhizosphere	MRTLKLHFADDALPTLDAFLKRTKEARIFRRAQAVREVIKGQR
Ga0134081_103402891	3300014150	Grasslands Soil	MRTLQLHFSANALPTLNTFLQQTKEARVFRRAQAVRDVVTGQ
Ga0075313_10903773	3300014267	Natural And Restored Wetlands	MRPLNSHFSHDALPTLDTFMKHSKDARVFRRAQAVREVV
Ga0075322_11360801	3300014311	Natural And Restored Wetlands	MRPLSSHFVHDALPTLDAFIKQTKKARVFRRAQAVREVVAGHTVK
Ga0132258_110698904	3300015371	Arabidopsis Rhizosphere	MRTLKLPFPDTALSTLDTFLKQTREVRVFRRAQAVR
Ga0182033_109461262	3300016319	Soil	MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRHVVNGQRLQ
Ga0182033_119762051	3300016319	Soil	MRTLQLHFADDALPTLDMALKQTKDARIFRRAQAVREVVKGQRLQTV
Ga0182035_121638032	3300016341	Soil	MRTLKLQFPDDALPTLDTFLKQTKEARVFRRAQAVRAVV
Ga0182032_101005134	3300016357	Soil	MRTLKLHVPDAALPPWDPFVQQTKEARVFRRAQAVR
Ga0182034_105836552	3300016371	Soil	MRPLKSHFPDHALTTLDTLLKQTKEARVFRRAQAVREVVA
Ga0182039_103066561	3300016422	Soil	MRTLKLYFPDDALSTLDTFVKQTTEARVFRRAQAVRQV
Ga0134083_102905602	3300017659	Grasslands Soil	MRTLTLHFPDDALPTLETFLHQTTKARIFRRAQAVRAVVKGQRLQT
Ga0190266_105697832	3300017965	Soil	MRTLKLHFPDEALPTLDTCLKQTKEARVFRRAQAV
Ga0184621_101087711	3300018054	Groundwater Sediment	MRTLQLHFPDDALPTLDTVLKQTKEARVFRRAQAVREVVK
Ga0180109_13564862	3300020067	Groundwater Sediment	MWTLKLHFCEDALPTLDTFVKQTTEARVFRRAQAVRA
Ga0207643_104314041	3300025908	Miscanthus Rhizosphere	MRTLKLHFPDDALPTLDTFVKQTREARVFRRAQAVREVVKGQRLQTVS
Ga0207712_101392533	3300025961	Switchgrass Rhizosphere	MRTLQLQCPETALPTLETVLKETKEVRVFRRAQAV
Ga0209239_11047091	3300026310	Grasslands Soil	MRTLKLHFPDEALPTLDTYLKQTKEARVFRRAQAVREVVK
Ga0209984_10618201	3300027424	Arabidopsis Thaliana Rhizosphere	MRTLTLHFPDQALPTLDTFLKQTKEARIFRRAQAVRAVVQGHRLQ
Ga0209974_101055892	3300027876	Arabidopsis Thaliana Rhizosphere	MRPLNSHFPHHALPTLDTFMKHSKEARVFRRAQAVRE
Ga0209481_104635922	3300027880	Populus Rhizosphere	MRTLKLHFPDDALPTLDTFLKQAKEARVFRRAQAVRAVVKGHRLQT
Ga0209382_102635555	3300027909	Populus Rhizosphere	MRTLKLHFPDDALSTLDTFLKQTKEARVFRRAQAVHHVVKG
Ga0247819_107318202	3300028608	Soil	MRTLKLHFPDDALPTLENFLKQTKEARIFCRAQAVREVVQGHPY
Ga0308206_11142052	3300030903	Soil	MRPLKSHFPANALPTLETVLKQTQEARVFRRAQAVREVVAGHHVH
Ga0308200_11330492	3300030905	Soil	MRPLKSHFSDQALPTLETILKQTKEARVFRRAQAVREVVAG
Ga0308197_103468751	3300031093	Soil	MRTLKLHFPDDTLPALDIFLKQTKEARVFRRAQAVRDVVKGQYLQTVS
Ga0308194_101205381	3300031421	Soil	MRTLQLHFPEDALPTLDTVLKQTKEARVFRRAQAVR
Ga0318538_103787871	3300031546	Soil	MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRHVVNGQRLQT
Ga0307469_117807972	3300031720	Hardwood Forest Soil	MRPLKSHFPDHALSTLDTVLKQTKEARVFRRAQAVQAVVAGQHV
Ga0307468_1018065701	3300031740	Hardwood Forest Soil	MRPLKLHCPHDALTTLDPFVKQTKEARVFRRAQAVREVVKG
Ga0318548_103988432	3300031793	Soil	MTLKLHFPDQALPTLETFLKQTKEARIFRRAQAVREVVHGHRRQ
Ga0306923_103782041	3300031910	Soil	MTLKLHFPDQALPTLETFLKQTKEARIFRRAQAVREVVQ
Ga0306921_115059402	3300031912	Soil	MRTLKLHVPDAALPPWDPFVQQTKEARVFRRAQAVRAVERRG
Ga0310912_103099182	3300031941	Soil	MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRHVVNGQRLQTV
Ga0318533_100199167	3300032059	Soil	MRPLKSHFHADALTTLDTVLKQTKEARVFRRAQAVREVVAG
Ga0307471_1017478091	3300032180	Hardwood Forest Soil	MRTLKLHFPDEALPTLDIYLKQTKEARVFRRAQAVREVVKGQRLQ
Ga0307472_1010662821	3300032205	Hardwood Forest Soil	MRTLKLHFPDDALPTLDTFFKQTKAARVFRRAQAVRNVVQGQRLHTV
Ga0247829_103104812	3300033550	Soil	MRPLKSHFRADALTTLEAVLPQTKEARVFRRAQAVRE
Ga0314782_187353_393_527	3300034661	Soil	MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRDVVKGQRLQ

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign