Scaffold WWPM1086_GHCZ4414_g1

Overview

Basic Information

• Taxon OID: 2035918001
• Scaffold ID: WWPM1086_GHCZ4414_g1
• Source Dataset Name: Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Visp-2009 (Newbler)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 726
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools → Activated Sludge Microbial Communities From Commune De Morges, Switzerland

Source Dataset Sampling Location

• Location Name: Visp, Switzerland
• Coordinates
  • Lat. (^o): 46.30044
  • Long. (^o): 7.8594

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070808	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
WWPMV_472090	F070808	N/A	TFKAPYFEYLVRSSAQHFTDLIVVAERIEQAIGLGKIANPIEKNGFNEKGKETEGGCQGTYCSYS