Basic Information | |
---|---|
Taxon OID | 2035918000 Open in IMG/M |
Scaffold ID | AECF_F56XM5W02GSS22 Open in IMG/M |
Source Dataset Name | Acromyrmex echinatior fungus garden microbial communities from Panama |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 504 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Acromyrmex Echinatior Fungus Garden → Acromyrmex Echinatior Fungus Garden Microbial Communities From Gamboa, Panama |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gamboa, Panama | |||||||
Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023692 | Metagenome / Metatranscriptome | 209 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
AECFG_195090 | F023692 | AGGAG | MRILFGIAIAAVVAFTAWSVEPTIGKTPSTVSLDPHGMMATTTNLPQAHYDDFSTIY |
⦗Top⦘ |