NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2035918000

2035918000: Acromyrmex echinatior fungus garden microbial communities from Panama



Overview

Basic Information
IMG/M Taxon OID2035918000 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0045514 | Gp0051601 | Ga0010960
Sample NameAcromyrmex echinatior fungus garden microbial communities from Panama
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size61239920
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Acidobacteria1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAcromyrmex Echinatior Fungus Garden Microbial Communities From Gamboa, Panama
TypeHost-Associated
TaxonomyHost-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Acromyrmex Echinatior Fungus Garden → Acromyrmex Echinatior Fungus Garden Microbial Communities From Gamboa, Panama

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Fungus → Fungus corpus

Location Information
LocationGamboa, Panama
CoordinatesLat. (o)9.1167Long. (o)-79.7Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023692Metagenome / Metatranscriptome209Y
F028352Metagenome192Y
F054708Metagenome / Metatranscriptome139Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
AECF_F56XM5W02F7IKMAll Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
AECF_F56XM5W02GC1Y1All Organisms → cellular organisms → Bacteria510Open in IMG/M
AECF_F56XM5W02GSS22All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
AECF_F56XM5W02F7IKMAECFG_1205640F054708IKLPYTKKGGKFSFDLHHRIAMTEDFGLPAEVTTVVEVLSGGTTSLGVFTIADKINPGDKFDEPIVKASSAEIDRFITPMYRKTITMDIRPGPQSISIVGQMLIITRGAITTRVDTPGTRIAVVSNFKFAETSLGVPLTR
AECF_F56XM5W02GC1Y1AECFG_1442430F028352TASLFKFRAVTFRPSPLAESLIDTAHWLVVPNQHVPLRVFRFGLALVVVAFHITLTPLAYATPPDPTWQLSLFDDDDFDDIVGYITSAAALAEAPVERCLRFAPVLVVLRCSSAEDPAPFVPLSSADPRAPPAPLSV
AECF_F56XM5W02GSS22AECFG_195090F023692MRILFGIAIAAVVAFTAWSVEPTIGKTPSTVSLDPHGMMATTTNLPQAHYDDFSTIY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.