Basic Information | |
---|---|
IMG/M Taxon OID | 2035918000 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045514 | Gp0051601 | Ga0010960 |
Sample Name | Acromyrmex echinatior fungus garden microbial communities from Panama |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 61239920 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Acidobacteria | 1 |
All Organisms → cellular organisms → Bacteria | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Acromyrmex Echinatior Fungus Garden Microbial Communities From Gamboa, Panama |
Type | Host-Associated |
Taxonomy | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Acromyrmex Echinatior Fungus Garden → Acromyrmex Echinatior Fungus Garden Microbial Communities From Gamboa, Panama |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Fungus → Fungus corpus |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Gamboa, Panama | |||||||
Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023692 | Metagenome / Metatranscriptome | 209 | Y |
F028352 | Metagenome | 192 | Y |
F054708 | Metagenome / Metatranscriptome | 139 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
AECF_F56XM5W02F7IKM | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
AECF_F56XM5W02GC1Y1 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
AECF_F56XM5W02GSS22 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
AECF_F56XM5W02F7IKM | AECFG_1205640 | F054708 | IKLPYTKKGGKFSFDLHHRIAMTEDFGLPAEVTTVVEVLSGGTTSLGVFTIADKINPGDKFDEPIVKASSAEIDRFITPMYRKTITMDIRPGPQSISIVGQMLIITRGAITTRVDTPGTRIAVVSNFKFAETSLGVPLTR |
AECF_F56XM5W02GC1Y1 | AECFG_1442430 | F028352 | TASLFKFRAVTFRPSPLAESLIDTAHWLVVPNQHVPLRVFRFGLALVVVAFHITLTPLAYATPPDPTWQLSLFDDDDFDDIVGYITSAAALAEAPVERCLRFAPVLVVLRCSSAEDPAPFVPLSSADPRAPPAPLSV |
AECF_F56XM5W02GSS22 | AECFG_195090 | F023692 | MRILFGIAIAAVVAFTAWSVEPTIGKTPSTVSLDPHGMMATTTNLPQAHYDDFSTIY |
⦗Top⦘ |