| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2035918000 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045514 | Gp0051601 | Ga0010960 |
| Sample Name | Acromyrmex echinatior fungus garden microbial communities from Panama |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 61239920 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Acidobacteria | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Acromyrmex Echinatior Fungus Garden Microbial Communities From Gamboa, Panama |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Acromyrmex Echinatior Fungus Garden → Acromyrmex Echinatior Fungus Garden Microbial Communities From Gamboa, Panama |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Fungus → Fungus corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gamboa, Panama | |||||||
| Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023692 | Metagenome / Metatranscriptome | 209 | Y |
| F028352 | Metagenome | 192 | Y |
| F054708 | Metagenome / Metatranscriptome | 139 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| AECF_F56XM5W02F7IKM | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| AECF_F56XM5W02GC1Y1 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| AECF_F56XM5W02GSS22 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| AECF_F56XM5W02F7IKM | AECFG_1205640 | F054708 | IKLPYTKKGGKFSFDLHHRIAMTEDFGLPAEVTTVVEVLSGGTTSLGVFTIADKINPGDKFDEPIVKASSAEIDRFITPMYRKTITMDIRPGPQSISIVGQMLIITRGAITTRVDTPGTRIAVVSNFKFAETSLGVPLTR |
| AECF_F56XM5W02GC1Y1 | AECFG_1442430 | F028352 | TASLFKFRAVTFRPSPLAESLIDTAHWLVVPNQHVPLRVFRFGLALVVVAFHITLTPLAYATPPDPTWQLSLFDDDDFDDIVGYITSAAALAEAPVERCLRFAPVLVVLRCSSAEDPAPFVPLSSADPRAPPAPLSV |
| AECF_F56XM5W02GSS22 | AECFG_195090 | F023692 | MRILFGIAIAAVVAFTAWSVEPTIGKTPSTVSLDPHGMMATTTNLPQAHYDDFSTIY |
| ⦗Top⦘ |