| Basic Information | |
|---|---|
| Taxon OID | 2035918000 Open in IMG/M |
| Scaffold ID | AECF_F56XM5W02GC1Y1 Open in IMG/M |
| Source Dataset Name | Acromyrmex echinatior fungus garden microbial communities from Panama |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 510 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Acromyrmex Echinatior Fungus Garden → Acromyrmex Echinatior Fungus Garden Microbial Communities From Gamboa, Panama |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gamboa, Panama | |||||||
| Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028352 | Metagenome | 192 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| AECFG_1442430 | F028352 | N/A | TASLFKFRAVTFRPSPLAESLIDTAHWLVVPNQHVPLRVFRFGLALVVVAFHITLTPLAYATPPDPTWQLSLFDDDDFDDIVGYITSAAALAEAPVERCLRFAPVLVVLRCSSAEDPAPFVPLSSADPRAPPAPLSV |
| ⦗Top⦘ |