| Basic Information | |
|---|---|
| Taxon OID | 2032320005 Open in IMG/M |
| Scaffold ID | FACEOR_FY84VJD01DV5P6 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 513 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Oak Ridge National Environmental Research Park, Tennessee, USA | |||||||
| Coordinates | Lat. (o) | 35.9 | Long. (o) | -84.4 | Alt. (m) | Depth (m) | .05 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087576 | Metagenome / Metatranscriptome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FACEORA_788060 | F087576 | N/A | CATTFHPLRLTKLAQGLDDGEYAYSWLEEREPGVGDSDGDPAGVTSHF |
| ⦗Top⦘ |