| Basic Information | |
|---|---|
| Family ID | F087576 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TKLAKKLDDGEYAYSWLEERVPAAGDADEDPAGVTSHF |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.82 % |
| % of genes near scaffold ends (potentially truncated) | 97.27 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (26.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.09% β-sheet: 0.00% Coil/Unstructured: 90.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF12710 | HAD | 33.64 |
| PF00480 | ROK | 20.91 |
| PF01557 | FAA_hydrolase | 2.73 |
| PF00353 | HemolysinCabind | 2.73 |
| PF00730 | HhH-GPD | 1.82 |
| PF01391 | Collagen | 1.82 |
| PF01979 | Amidohydro_1 | 1.82 |
| PF01380 | SIS | 1.82 |
| PF02518 | HATPase_c | 0.91 |
| PF00528 | BPD_transp_1 | 0.91 |
| PF00563 | EAL | 0.91 |
| PF14534 | DUF4440 | 0.91 |
| PF04209 | HgmA_C | 0.91 |
| PF01614 | IclR | 0.91 |
| PF03631 | Virul_fac_BrkB | 0.91 |
| PF13586 | DDE_Tnp_1_2 | 0.91 |
| PF16296 | TM_PBP2_N | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 41.82 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.82 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.82 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.82 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.82 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.82 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.91 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.91 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.91 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.91 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.91 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.91 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.73 % |
| Unclassified | root | N/A | 17.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01DV5P6 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 2189573001|GZR05M101DAMUU | Not Available | 518 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11154990 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300000956|JGI10216J12902_108443449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300000956|JGI10216J12902_116379814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300000956|JGI10216J12902_118412111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300001664|P5cmW16_1028279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1056 | Open in IMG/M |
| 3300004114|Ga0062593_101857414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
| 3300004480|Ga0062592_100428070 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300004643|Ga0062591_102260057 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005437|Ga0070710_10117866 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300005440|Ga0070705_100424665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| 3300005456|Ga0070678_100211299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1608 | Open in IMG/M |
| 3300005471|Ga0070698_100014317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8382 | Open in IMG/M |
| 3300005540|Ga0066697_10630579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300005558|Ga0066698_10498964 | Not Available | 827 | Open in IMG/M |
| 3300005718|Ga0068866_10591067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300005844|Ga0068862_100993326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 830 | Open in IMG/M |
| 3300006175|Ga0070712_100334726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
| 3300006791|Ga0066653_10705780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300006804|Ga0079221_11212205 | Not Available | 587 | Open in IMG/M |
| 3300006852|Ga0075433_10257233 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300006876|Ga0079217_11306496 | Not Available | 560 | Open in IMG/M |
| 3300006904|Ga0075424_102106026 | Not Available | 594 | Open in IMG/M |
| 3300009012|Ga0066710_101950507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
| 3300009012|Ga0066710_103185317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300009098|Ga0105245_10034418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4493 | Open in IMG/M |
| 3300009098|Ga0105245_10739596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1019 | Open in IMG/M |
| 3300009100|Ga0075418_11725873 | Not Available | 681 | Open in IMG/M |
| 3300009137|Ga0066709_103966744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300009148|Ga0105243_11773746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
| 3300009156|Ga0111538_11630182 | Not Available | 813 | Open in IMG/M |
| 3300009162|Ga0075423_10326169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1610 | Open in IMG/M |
| 3300009176|Ga0105242_10278949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1517 | Open in IMG/M |
| 3300009812|Ga0105067_1017039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 977 | Open in IMG/M |
| 3300009813|Ga0105057_1023773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 910 | Open in IMG/M |
| 3300010038|Ga0126315_11221879 | Not Available | 511 | Open in IMG/M |
| 3300010039|Ga0126309_10508733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
| 3300010044|Ga0126310_10815030 | Not Available | 719 | Open in IMG/M |
| 3300010044|Ga0126310_11838178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300010109|Ga0127497_1074577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
| 3300010145|Ga0126321_1181029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300010166|Ga0126306_10020492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4359 | Open in IMG/M |
| 3300010360|Ga0126372_13252894 | Not Available | 505 | Open in IMG/M |
| 3300010371|Ga0134125_10961356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 937 | Open in IMG/M |
| 3300010396|Ga0134126_11740121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300010396|Ga0134126_12754415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300011412|Ga0137424_1000857 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
| 3300012011|Ga0120152_1145022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300012096|Ga0137389_10840968 | Not Available | 788 | Open in IMG/M |
| 3300012354|Ga0137366_10470663 | Not Available | 909 | Open in IMG/M |
| 3300012356|Ga0137371_10132379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1952 | Open in IMG/M |
| 3300012892|Ga0157294_10265672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300012902|Ga0157291_10347241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300012905|Ga0157296_10198459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300012960|Ga0164301_11597791 | Not Available | 541 | Open in IMG/M |
| 3300012961|Ga0164302_11424210 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012989|Ga0164305_10308386 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300013306|Ga0163162_12931968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300014497|Ga0182008_10748125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300015201|Ga0173478_10859101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300015374|Ga0132255_105663554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300017965|Ga0190266_10552488 | Not Available | 685 | Open in IMG/M |
| 3300018027|Ga0184605_10263600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
| 3300018073|Ga0184624_10229993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 830 | Open in IMG/M |
| 3300018074|Ga0184640_10306792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300018089|Ga0187774_10727480 | Not Available | 660 | Open in IMG/M |
| 3300018431|Ga0066655_10712820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300018433|Ga0066667_10214613 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300018476|Ga0190274_13711412 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300019259|Ga0184646_1140243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300019361|Ga0173482_10403128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
| 3300020059|Ga0193745_1015657 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300022195|Ga0222625_1349550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300024254|Ga0247661_1097614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300024317|Ga0247660_1024688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 954 | Open in IMG/M |
| 3300025927|Ga0207687_11076388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300025928|Ga0207700_10284979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1422 | Open in IMG/M |
| 3300025932|Ga0207690_10698031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
| 3300025935|Ga0207709_10369826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1088 | Open in IMG/M |
| 3300026295|Ga0209234_1042823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1721 | Open in IMG/M |
| 3300027169|Ga0209897_1048243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300027310|Ga0207983_1011627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1012 | Open in IMG/M |
| 3300027695|Ga0209966_1116021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300027821|Ga0209811_10318927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300028380|Ga0268265_11326603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300028707|Ga0307291_1002893 | All Organisms → cellular organisms → Bacteria | 3716 | Open in IMG/M |
| 3300028715|Ga0307313_10189548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300028717|Ga0307298_10011509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2212 | Open in IMG/M |
| 3300028717|Ga0307298_10245583 | Not Available | 531 | Open in IMG/M |
| 3300028720|Ga0307317_10225335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300028721|Ga0307315_10095610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 870 | Open in IMG/M |
| 3300028721|Ga0307315_10246725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300028787|Ga0307323_10132025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 899 | Open in IMG/M |
| 3300028799|Ga0307284_10002773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4655 | Open in IMG/M |
| 3300028810|Ga0307294_10428875 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300028811|Ga0307292_10185281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
| 3300028814|Ga0307302_10050698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1931 | Open in IMG/M |
| 3300028828|Ga0307312_10078253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2018 | Open in IMG/M |
| 3300028828|Ga0307312_11091929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300028878|Ga0307278_10249325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 788 | Open in IMG/M |
| 3300028881|Ga0307277_10441773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300028881|Ga0307277_10545632 | Not Available | 520 | Open in IMG/M |
| 3300030006|Ga0299907_10062652 | All Organisms → cellular organisms → Bacteria | 2988 | Open in IMG/M |
| 3300030336|Ga0247826_11229945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300031890|Ga0306925_11703290 | Not Available | 608 | Open in IMG/M |
| 3300031903|Ga0307407_10657006 | Not Available | 786 | Open in IMG/M |
| 3300031910|Ga0306923_12225929 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032954|Ga0335083_10618398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300033551|Ga0247830_11707203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 26.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.45% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.73% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.91% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_788060 | 2032320005 | Soil | CATTFHPLRLTKLAQGLDDGEYAYSWLEEREPGVGDSDGDPAGVTSHF |
| FD2_02542280 | 2189573001 | Grass Soil | LAQGLDDGEYAYSWLEERAPEVGDSDGDPAGVTSHF |
| ICChiseqgaiiFebDRAFT_111549901 | 3300000363 | Soil | FHPLRLTKLAKKLDDGKYAYSWLEERAPAAGNADEDPAGVTSHF* |
| JGI10216J12902_1084434491 | 3300000956 | Soil | RELDDGEYAYSWLEERVPAGESADEDPAGVTSHF* |
| JGI10216J12902_1163798142 | 3300000956 | Soil | FHPLKLSALAKETEDPTYAYSWYEEPDAAKEAKNADEDPAGVTSHF* |
| JGI10216J12902_1184121112 | 3300000956 | Soil | FHPLRLTAFARELDDPAYAYSWYEPSDAAKEAASADEDPAGVTSHF* |
| P5cmW16_10282793 | 3300001664 | Permafrost | TKLAKGLDDGEYAYSWYEEPDAVKEAKSADEDPAGVTSHF* |
| Ga0062593_1018574141 | 3300004114 | Soil | RLTTLGQTMDDGQYAYSWNEDLVPQADATPDDDPAGVTSHF* |
| Ga0062592_1004280701 | 3300004480 | Soil | RLSPLARDTEDPKYAYSWYEEPEAAKDARTADEDPAGVTSHF* |
| Ga0062591_1022600571 | 3300004643 | Soil | FHPLRLTKLAKGLDDGEYAYSWLEERAPAAGDSDADPAGVTSHF* |
| Ga0070710_101178663 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PLRLTPFAHGLDDGTYAYSWYEEPAAPGDTADDDPAGVTSHF* |
| Ga0070705_1004246652 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | HPLRLTKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF* |
| Ga0070678_1002112993 | 3300005456 | Miscanthus Rhizosphere | LTKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF* |
| Ga0070698_1000143171 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LTKLAKGLDDGEYAYSWLDERVPAAGSPDEDPAGVTSHF* |
| Ga0066697_106305792 | 3300005540 | Soil | KKLDDGQYAYSWLDEGAPPVESADEDPAGVTSHF* |
| Ga0066698_104989641 | 3300005558 | Soil | LTKLAKELDDGTYWHSWFEDPAPVSTADEDPAGVTSHF* |
| Ga0068866_105910672 | 3300005718 | Miscanthus Rhizosphere | TEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF* |
| Ga0068862_1009933261 | 3300005844 | Switchgrass Rhizosphere | TKLAKGLDDGKYAYSWLEEHAPADADEDPAGVTSHF* |
| Ga0070712_1003347263 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RLTKLAMGLDDGEYAYSWLEEHAAGAGDSDADPAGVTSHF* |
| Ga0066653_107057801 | 3300006791 | Soil | PLKLSALARETEDPTYAYSWYEEPEAAKEARTADEDPAGVTSHF* |
| Ga0079221_112122052 | 3300006804 | Agricultural Soil | MSVDWMRLTPFAHGLDDGTYAYSWYEEPAAPGDTADDDPAGVTSHF* |
| Ga0075433_102572333 | 3300006852 | Populus Rhizosphere | KLAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF* |
| Ga0079217_113064962 | 3300006876 | Agricultural Soil | LAREQDDPRYAYSWYDEPTAVRTADEDPAGVTSHL* |
| Ga0075424_1021060262 | 3300006904 | Populus Rhizosphere | LAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF* |
| Ga0066710_1019505071 | 3300009012 | Grasslands Soil | PLRLTKLAKGLDDGEYAYSWLDERAPAAGSADEDPAGVTSHF |
| Ga0066710_1031853172 | 3300009012 | Grasslands Soil | AKKLDDGQYAYSWLDERAPAAESADEDPAGVTSHF |
| Ga0105245_100344181 | 3300009098 | Miscanthus Rhizosphere | PLRLTKLAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF* |
| Ga0105245_107395961 | 3300009098 | Miscanthus Rhizosphere | LAKKLDDGEYAYSWLDERAPAEGSTDEDPAGVTSHF* |
| Ga0075418_117258731 | 3300009100 | Populus Rhizosphere | HPLRLGKLAAGLDDGRYAFSWLEDPEPVKTADEDPAGVTSHF* |
| Ga0066709_1039667442 | 3300009137 | Grasslands Soil | TKLAKKLDDGEYAYSWLEERVPAAGDADEDPAGVTSHF* |
| Ga0105243_117737461 | 3300009148 | Miscanthus Rhizosphere | LTKLAKGLDDGKYAYSWLEEHVPADADEDPAGVTSHF* |
| Ga0111538_116301823 | 3300009156 | Populus Rhizosphere | TLARDLDKPEYAYSWYEAPDQPATADENPAGVTSHF* |
| Ga0075423_103261693 | 3300009162 | Populus Rhizosphere | RLTKLAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF* |
| Ga0105242_102789491 | 3300009176 | Miscanthus Rhizosphere | RLTKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF* |
| Ga0105067_10170393 | 3300009812 | Groundwater Sand | LTELALELDDPGYAYSWYEAAEATKEAASSDEDPAGVTSHL* |
| Ga0105057_10237731 | 3300009813 | Groundwater Sand | PLRLAAFARELDEPGYAYSWFEAPEAAKAAKTADEDPAGVTSHF* |
| Ga0126315_112218791 | 3300010038 | Serpentine Soil | RLTTLARELDDGHYAYSWYEEPAPAGSADENPAGVTSHF* |
| Ga0126309_105087332 | 3300010039 | Serpentine Soil | LTKLAKKLDDGEYAYSWLEERAPATGDADEDPAGVTSHF* |
| Ga0126310_108150302 | 3300010044 | Serpentine Soil | KLAKELDDGTYWRSWFEDPAPAANADEDPAGVTSHF* |
| Ga0126310_118381782 | 3300010044 | Serpentine Soil | TALAADLDDGRYAYSWAEDPGPADARNADEDPAGVTSHF* |
| Ga0127497_10745772 | 3300010109 | Grasslands Soil | VRHVPPLRLTALAKELDDGEYAYSWLEERVPAGESPDEDPAGVTSHF* |
| Ga0126321_11810291 | 3300010145 | Soil | LDDPAYAYSWYEESDAAKQAKDADEDPAGVTSHF* |
| Ga0126306_100204921 | 3300010166 | Serpentine Soil | KLAKGLDDGKYAYSWYEAADQSADADENPAGVTSHF* |
| Ga0126372_132528941 | 3300010360 | Tropical Forest Soil | ELARGLDDGRYMYSWYEAPEYAREAADTDEDPAGVTSHF* |
| Ga0134125_109613561 | 3300010371 | Terrestrial Soil | LAKKLDDGEYAYSWLEERAPEAGDTNADPAGVTSHF* |
| Ga0134126_117401212 | 3300010396 | Terrestrial Soil | HPLKLSALAKDTEDPSYAYSWYEEPDAVKEAKNADEDPAGVTSHF* |
| Ga0134126_127544151 | 3300010396 | Terrestrial Soil | PLRLTKLAKDLDDGEYAYSWLDERAPAAGDTDEDPAGVTSHF* |
| Ga0137424_10008575 | 3300011412 | Soil | SALARELDDPGYGYSWFEAGEGAESADEDPAGVTSHL* |
| Ga0120152_11450222 | 3300012011 | Permafrost | RLTKFSKELDDPSYAYSWYEEPDAVKEAKTADEDPAGVTSHF* |
| Ga0137389_108409683 | 3300012096 | Vadose Zone Soil | LRLTTFARELDDGKYAYSWDEEPGAAASTDDDPAGVTSHF* |
| Ga0137366_104706631 | 3300012354 | Vadose Zone Soil | KKLDDGEYAYSWLEERAPVAGSADEDPAGVTSHF* |
| Ga0137371_101323794 | 3300012356 | Vadose Zone Soil | TKLARELDDGKYWHSWFEDPAPVGTADEDPAGVTSHF* |
| Ga0157294_102656721 | 3300012892 | Soil | TEDPAYAYSWYEEPDAVKEAKNADEDPAGVTSHF* |
| Ga0157291_103472412 | 3300012902 | Soil | LDDGKYAYSWYEEPESVKEATNADEDPAGVTSHF* |
| Ga0157296_101984591 | 3300012905 | Soil | HPLKLSALAKDTEDPEYAYSWYEEPDAVKDAKNADEDPAGVTSHF* |
| Ga0164301_115977912 | 3300012960 | Soil | KKLDDGKYAYSWLEERAPAGGSPDEDPAGVTSHF* |
| Ga0164302_114242102 | 3300012961 | Soil | CDTFHPLRLTKLAKDLDDGTYWHSWFEDPAPVGNADEDPAGVTSHF* |
| Ga0164305_103083863 | 3300012989 | Soil | AKDLDDGTYWHSWFEDPAPVGNADEDPAGVTSHF* |
| Ga0163162_129319682 | 3300013306 | Switchgrass Rhizosphere | KLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHV* |
| Ga0182008_107481251 | 3300014497 | Rhizosphere | FHPLRLTKLAKSMDDGEYAYSWLDDRVPAAGNADEDPAGVTSHF* |
| Ga0173478_108591012 | 3300015201 | Soil | ALAKETEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF* |
| Ga0132255_1056635542 | 3300015374 | Arabidopsis Rhizosphere | KDTEDPKYAYSWYEEPDAAKEARNADEDPAGVTSHF* |
| Ga0190266_105524882 | 3300017965 | Soil | KLAKSLDDGKYAYSWYDTPDQPADADENPAGVTSHF |
| Ga0184605_102636002 | 3300018027 | Groundwater Sediment | RLTKLAKELDDGEYAYSWLDERAPAAGSADEDPAGVTSHF |
| Ga0184624_102299931 | 3300018073 | Groundwater Sediment | RLTELAKGLDDPAYAYSWFEADAAPDAASGDEDPAGVTSHF |
| Ga0184640_103067921 | 3300018074 | Groundwater Sediment | LAKGLDDPAYAYSWFEADAAPDAASGDEDPAGVTSHF |
| Ga0187774_107274801 | 3300018089 | Tropical Peatland | PLRLTTFARDLDDGKYWRSWYDDPTPTGDADADPAGVTSHL |
| Ga0066655_107128202 | 3300018431 | Grasslands Soil | DTFHPLRLTKLAKKLDDGQYAYSWLDERAPAAESADEDPAGVTSHF |
| Ga0066667_102146131 | 3300018433 | Grasslands Soil | PLRLTTLALELDDPSYAYSWHEESGAAASADEDPAGVTSHL |
| Ga0190274_137114122 | 3300018476 | Soil | FHPLKLTKLAKSLDDGKYAYSWYDTPDQPADADENPAGVTSHF |
| Ga0184646_11402431 | 3300019259 | Groundwater Sediment | ARELDDPSYAYSWYEEPAAAKVASSADEDPAGVTSHL |
| Ga0173482_104031282 | 3300019361 | Soil | SPLARDTEDPKYAYSWYEEPEAAKDARTADEDPAGVTSHF |
| Ga0193745_10156571 | 3300020059 | Soil | RLTKLAKKLDDGKYWRSWSEDHAPAAANADEDPAGVTSHF |
| Ga0222625_13495501 | 3300022195 | Groundwater Sediment | LTELARELDDPSYAYSWYEEPAAAKVASSADEDPAGVTSHL |
| Ga0247661_10976142 | 3300024254 | Soil | KLAMGLDDGEYAYSWLEEHAAGAGDSDADPAGVTSHF |
| Ga0247660_10246882 | 3300024317 | Soil | DTFHPLRLTKLAMGLDDGEYAYSWLEEHAAGAGDSDADPAGVTSHF |
| Ga0207687_110763883 | 3300025927 | Miscanthus Rhizosphere | KLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF |
| Ga0207700_102849793 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | HPLRLTKLAQGLDDGEYAYSWLEERAPAGDADEDPAGVTSHF |
| Ga0207690_106980311 | 3300025932 | Corn Rhizosphere | TKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF |
| Ga0207709_103698261 | 3300025935 | Miscanthus Rhizosphere | LSALAKDTEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF |
| Ga0209234_10428231 | 3300026295 | Grasslands Soil | LAKDLDDGTYWRSWFEDPAPVGNADEDPAGVTSHF |
| Ga0209897_10482431 | 3300027169 | Groundwater Sand | AFARELDEPGYAYSWFEAPEAAKAAKTADEDPAGVTSHF |
| Ga0207983_10116271 | 3300027310 | Soil | MHARPAVKLTKLAKGLDDGKYAYSWYDSPDQPADADENPAGVTSHF |
| Ga0209966_11160211 | 3300027695 | Arabidopsis Thaliana Rhizosphere | PLRLTKLAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF |
| Ga0209811_103189272 | 3300027821 | Surface Soil | ALAKDTEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF |
| Ga0268265_113266031 | 3300028380 | Switchgrass Rhizosphere | FHPLRLTKLAKGLDDGKYAYSWLEEHAPADADEDPAGVTSHF |
| Ga0307291_10028935 | 3300028707 | Soil | LTKLAKKLDDGEYAYSWLDERAPAEGNTDEDPAGVTSHF |
| Ga0307313_101895482 | 3300028715 | Soil | TKLAKGLDDGKYAYSWLEEHVPADADEDPAGVTSHF |
| Ga0307298_100115091 | 3300028717 | Soil | AKETEDPAYAYSWYEEPDAVKEAKNADEDPAGVTSHF |
| Ga0307298_102455831 | 3300028717 | Soil | LRLTELARELDEPSYAYSWYEEPAAAKGASSADQDPAGVTSHL |
| Ga0307317_102253352 | 3300028720 | Soil | LRLTELAKGLDDPAYAYSWFEADAAPDAASGDEDPAGVTSHF |
| Ga0307315_100956103 | 3300028721 | Soil | LAKELDDGKYAYSWYEEPEAVKEATNADEDPAGVTSHF |
| Ga0307315_102467251 | 3300028721 | Soil | TFHPLRLTKLAKKLDDGQYAYSWLEERTPAAGSADEDPAGVTSHF |
| Ga0307323_101320252 | 3300028787 | Soil | HPMRLTKLAKGLDDGKYAYSWLEEHVPADADEDPAGVTSHF |
| Ga0307284_100027731 | 3300028799 | Soil | LTKLAKGLDDGEYAYSWLDERTPAEGSTDEDPAGVTSHF |
| Ga0307294_104288751 | 3300028810 | Soil | PLRLTKLAKKLDDGQYAYSWLEERVPAAGDADEDPAGVTSHF |
| Ga0307292_101852812 | 3300028811 | Soil | PLRLTKLAKKLDDGKYWRSWSEDHSPAAENADEDPAGVTSHF |
| Ga0307302_100506984 | 3300028814 | Soil | ALAKETEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF |
| Ga0307312_100782534 | 3300028828 | Soil | LRLTKLAKGLDDGEYAYSWLDERAPAQGSTDEDPAGVTSHF |
| Ga0307312_110919291 | 3300028828 | Soil | RLTKLAKKLDDGEYAYSWLEERVPAGESADEDPAGVTSHF |
| Ga0307278_102493252 | 3300028878 | Soil | SDTFHPLRLTKLAKSLDDGEYAYSWLEERVPAAGNADEDPAGVTSHF |
| Ga0307277_104417731 | 3300028881 | Soil | LRLTKLAKELDDGKYAYSWSEPAEPAQDADADPAGVTSHF |
| Ga0307277_105456321 | 3300028881 | Soil | KLAKSLDDGEYAYSWLEERVPAAGNADEDPAGVTSHF |
| Ga0299907_100626525 | 3300030006 | Soil | FARGLDDPGYAYSWFEAPDAAKSAKTADEDPAGVTSHF |
| Ga0247826_112299452 | 3300030336 | Soil | FHPLKLTALAKETEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF |
| Ga0306925_117032901 | 3300031890 | Soil | LRLTTLARDLDDGVYWRSWFEEPADAAGADEDPAGVTSHF |
| Ga0307407_106570061 | 3300031903 | Rhizosphere | TKLAEELDDGEYAYSWNEDLVKTPAASTDEDPAGVTSHL |
| Ga0306923_122259291 | 3300031910 | Soil | DTFHPLRLTKLAQGLEDGTYWHSWFEDPAPVGSADEDPAGVTSHF |
| Ga0335083_106183981 | 3300032954 | Soil | LTKLAQALDDGEYAYSWLEERVPEAVDTDQDPAGVTSHF |
| Ga0247830_117072031 | 3300033551 | Soil | FHPLRVSALARGLDDPSYAYSWFEAPEAGTADQDPAGVTSHL |
| ⦗Top⦘ |