NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FACEOR_FY84VJD01BH33T

Scaffold FACEOR_FY84VJD01BH33T


Overview

Basic Information
Taxon OID2032320005 Open in IMG/M
Scaffold IDFACEOR_FY84VJD01BH33T Open in IMG/M
Source Dataset NameSoil microbial communities from sample at FACE Site 5 Oak Ridge CO2-
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)501
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameOak Ridge National Environmental Research Park, Tennessee, USA
CoordinatesLat. (o)35.9Long. (o)-84.4Alt. (m)Depth (m).05
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059316Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
FACEORA_438270F059316N/AMAVTFARTTDAADCLAAAGLATADIAAWLRAEPRELTDFPADCATFSEYWRRSAQLLGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.