| Basic Information | |
|---|---|
| Taxon OID | 2032320002 Open in IMG/M |
| Scaffold ID | FACENCE_FW6223E01D1G91 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 510 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | FACE Site 3 Nevada Test Site Creosote | |||||||
| Coordinates | Lat. (o) | 36.766667 | Long. (o) | -115.95 | Alt. (m) | Depth (m) | .05 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F095940 | Metagenome / Metatranscriptome | 105 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FACENCEE_9499580 | F095940 | N/A | RDAPCAAPTGSHPTETFVEACHLASLKTWRDSSLTADPLNPEGR |
| ⦗Top⦘ |