Scaffold ACOFG987_F36MELC01EQZFQ

Overview

Basic Information

• Taxon OID: 2029527005
• Scaffold ID: ACOFG987_F36MELC01EQZFQ
• Source Dataset Name: Atta colombica fungus garden Top
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 546
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Garden Dump → Leaf Cutter Ant → Leaf Cutter Ant Microbial Communities From The University Of Wisconsin-Madison, Usa, From Fungus Growing Ant-Garden

Source Dataset Sampling Location

• Location Name: Gamboa, Panama
• Coordinates
  • Lat. (^o): 9.1167
  • Long. (^o): -79.7
  • Depth (m): .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063112	Metagenome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
ACOFGT_362340	F063112	N/A	AARSYDLELKTIRKDGQMTDAEMENFIERLGDKKRPLDEVRDFSLVRQAIKELEGSK