| Basic Information | |
|---|---|
| Taxon OID | 2029527004 Open in IMG/M |
| Scaffold ID | ACEF_F3GTV4A02F8DYE Open in IMG/M |
| Source Dataset Name | Atta cephalotes fungus garden (ACEF) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 512 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Atta Cephalotes Fungus Garden → Atta Cephalotes Fungus Garden Microbial Communities From Gamboa, Panama |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gamboa, Panama | |||||||
| Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | Depth (m) | .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010740 | Metagenome | 300 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ACEFG_630550 | F010740 | AGAAG | MAFMDRKRNTDTAKNGYQIPMYQGGPPHEPYFIAIDNQDQIIIGPSKKIMAMHVVG |
| ⦗Top⦘ |