| Basic Information | |
|---|---|
| Taxon OID | 2027040001 Open in IMG/M |
| Scaffold ID | EFn_FUOFX6F01A4SDA Open in IMG/M |
| Source Dataset Name | Viral communities in wastewater treatment process (EF-no assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 513 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore: Singapore | |||||||
| Coordinates | Lat. (o) | 1.332 | Long. (o) | 103.756 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041729 | Metagenome | 159 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| EF_na_2546480 | F041729 | GGAGG | MKIFNGSVSIIKNTKGEIALKKDIEGKFSAANAAECHAKLMELSKKLKTPINKYSLFVADNGTEPIMLVNRYGNPYIALLPKRGDGNTKRNAVTKLA |
| ⦗Top⦘ |