| Basic Information | |
|---|---|
| Taxon OID | 2025206003 Open in IMG/M |
| Scaffold ID | LTJ07As871_J07ABscf085619 Open in IMG/M |
| Source Dataset Name | Hypersaline water microbial communities from Lake Tyrrell, Victoria, Australia, sample J07AB- all scaffolds |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1142 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Hypersaline Water Metagenomes Of Microbial Communities From Lake Tyrrell, Victoria, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Tyrrell, Victoria, Australia | |||||||
| Coordinates | Lat. (o) | -35.309 | Long. (o) | 142.7795 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054456 | Metagenome | 140 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LTJ07AB_173880 | F054456 | N/A | RWESVTNLQSDDLERLEKSDRNERYLEQAEGNQGSDDPPIPGGPLADAQHLAETPRDEWGKDERAEAEEAMNFFSRTLAQFDQSEGSPLIESESPKIHKDELSLMRWGVDPDPSDDFL |
| ⦗Top⦘ |