Scaffold YNPsite08_CeleraDRAF_72579

Overview

Basic Information

• Taxon OID: 2022920005
• Scaffold ID: YNPsite08_CeleraDRAF_72579
• Source Dataset Name: Hot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - YNP8 OSP Spring
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 676
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, WY
• Coordinates
  • Lat. (^o): 44.733519
  • Long. (^o): -110.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099548	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
YNPsite08_CeleraDRAFT_163730	F099548	N/A	ILIKGAPGDCVSITPSLLGNMIGDGAVREALRLLRVLYIQGILDRVNGAYTLCLEDNPQLWAIVKRLPIDEAVAWLLWLIEDALDGKPINTGPSFEL