Scaffold YNPsite08_CeleraDRAF_48626

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold YNPsite08_CeleraDRAF_48626

Scaffold YNPsite08_CeleraDRAF_48626

Overview

Basic Information
Taxon OID	2022920005 Open in IMG/M
Scaffold ID	YNPsite08_CeleraDRAF_48626 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - YNP8 OSP Spring
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	781
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park, WY
Coordinates	Lat. (^o)	44.733519	Long. (^o)	-110.7	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008606	Metagenome / Metatranscriptome	330	Y

Sequences

Protein ID	Family	RBS	Sequence
YNPsite08_CeleraDRAFT_15320	F008606	GGAGG	VAEARDPEGDPESRSYDKLVELSEQVNELRGQVVSLAERVTRLEEENRWLRQELAEIKGAVTDIRRNSVAILASVLTVLVAVVIGLIVH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.