| Basic Information | |
|---|---|
| Taxon OID | 2021593000 Open in IMG/M |
| Scaffold ID | TM1208_contig48096 Open in IMG/M |
| Source Dataset Name | Sample 264 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 541 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Unclassified → Unclassified → Unclassified → Tigriopus Californicus → Tigriopus Californicus Microbial Communities From Ocean Beach, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ocean Beach pier, California | |||||||
| Coordinates | Lat. (o) | 32.7497 | Long. (o) | -117.2574 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001587 | Metagenome / Metatranscriptome | 667 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TM1208A_228200 | F001587 | AGGAG | MNHLAPLSMSRNNPGKFVGDTRCEKLPVEILWVPGCVTEEGPEECHDKTITSLLDVPEEACDLNPQKTCRFQTKLVPKLEPKHECTIIPQETCNLKFTSPQQVEKPLKTKWCQDPTSPTPDETYDESTAIAPPIQFPQ |
| ⦗Top⦘ |