Basic Information | |
---|---|
Taxon OID | 2020627001 Open in IMG/M |
Scaffold ID | VrWwAS_contig45636 Open in IMG/M |
Source Dataset Name | Viral communities in wastewater treatment process (AS) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Illinois, Urbana-Champaign |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 510 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore: Singapore | |||||||
Coordinates | Lat. (o) | 1.332 | Long. (o) | 103.756 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082381 | Metagenome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
AS_214010 | F082381 | N/A | MGKENIKLKRGGKRPFSGRKKADYQTKTIAFRVRVQWVEAIKSMVKDKIADLSQNSS |
⦗Top⦘ |