NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold VrWwTxAD_contig18548

Scaffold VrWwTxAD_contig18548


Overview

Basic Information
Taxon OID2020350001 Open in IMG/M
Scaffold IDVrWwTxAD_contig18548 Open in IMG/M
Source Dataset NameViral communities in wastewater treatment process (AD)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)697
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore

Source Dataset Sampling Location
Location NameSingapore: Singapore
CoordinatesLat. (o)1.332Long. (o)103.756Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091585Metagenome107N

Sequences

Protein IDFamilyRBSSequence
AD_90650F091585N/AMENYFNIVQNTVFVSFVGLFAPFLFPYLFKIVGKWSKRELTKQEKRLLVGLVSFLVSIVIVAIGFNWQGELVERIMAFLMYIVLNFATLRGVVQSIYELVIKNIPSLDEEFDKIEKETKLLF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.