NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PelMarPul_NODE_934_len_496_cov_77_213707

Scaffold PelMarPul_NODE_934_len_496_cov_77_213707


Overview

Basic Information
Taxon OID2019105005 Open in IMG/M
Scaffold IDPelMarPul_NODE_934_len_496_cov_77_213707 Open in IMG/M
Source Dataset NameMarine microbial communities from Pulau Tioman, Malaysia
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterIllumina
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Community From Pulau Tioman, Malaysia

Source Dataset Sampling Location
Location NamePulau Tioman, Malaysia (South China Sea)
CoordinatesLat. (o)2.8Long. (o)104.2Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078588Metagenome116N

Sequences

Protein IDFamilyRBSSequence
MgKW_20260F078588AGAAGMNRLLFFSKQELTEQTYAVIRVTWYLKGKICGVSETAIGLYETDVIAEFSGLVGNALRAGCDVSVACIDDPHYLGIYEP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.