Scaffold PelMarPul_NODE_5499_len_487_cov_7_815195

Overview

Basic Information

• Taxon OID: 2019105005
• Scaffold ID: PelMarPul_NODE_5499_len_487_cov_7_815195
• Source Dataset Name: Marine microbial communities from Pulau Tioman, Malaysia
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Illumina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 513
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Community From Pulau Tioman, Malaysia

Source Dataset Sampling Location

• Location Name: Pulau Tioman, Malaysia (South China Sea)
• Coordinates
  • Lat. (^o): 2.8
  • Long. (^o): 104.2
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008797	Metagenome	328	Y

Sequences

Protein ID	Family	RBS	Sequence
MgKW_14590	F008797	N/A	KKRLKQDSWTYFEFFLACELGMTVSRLRNELTDAELIHFAAYHELKAEKEQKAMDRAKLQRR