| Basic Information | |
|---|---|
| Taxon OID | 2019105005 Open in IMG/M |
| Scaffold ID | PelMarPul_NODE_2007_len_634_cov_8_578864 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Pulau Tioman, Malaysia |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Illumina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 660 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Community From Pulau Tioman, Malaysia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pulau Tioman, Malaysia (South China Sea) | |||||||
| Coordinates | Lat. (o) | 2.8 | Long. (o) | 104.2 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078588 | Metagenome | 116 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MgKW_42130 | F078588 | GGAGG | MSWLDNLRKRKREEPTNRLLFFSKQELTEQAYAVVRVTWYLQGKICGVSETSIGLYDQDVIAEFSGVVSSALGAGCDVSVACIDDPHYLGIYES |
| ⦗Top⦘ |