Basic Information | |
---|---|
Taxon OID | 2019105005 Open in IMG/M |
Scaffold ID | PelMarPul_NODE_1390_len_554_cov_8_084838 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Pulau Tioman, Malaysia |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Illumina |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 580 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Community From Pulau Tioman, Malaysia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pulau Tioman, Malaysia (South China Sea) | |||||||
Coordinates | Lat. (o) | 2.8 | Long. (o) | 104.2 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011585 | Metagenome | 289 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MgKW_01620 | F011585 | N/A | MNLKEKLQQLAQERQNLQVAMIEITGAMKILEQQILEAEPELVQPSNTEASTQESKTKSLKSKA |
⦗Top⦘ |