Scaffold MAnammo_C2172

Overview

Basic Information

• Taxon OID: 2017108002
• Scaffold ID: MAnammo_C2172
• Source Dataset Name: Bioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 8539
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Nitrogen Removal → Anammox → Bioreactor → Bioreactor Anammox Bacterial Community From Nijmegen, The Netherlands

Source Dataset Sampling Location

• Location Name: Nijmegen, The Netherlands
• Coordinates
  • Lat. (^o): 51.842
  • Long. (^o): 5.858

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061392	Metagenome / Metatranscriptome	132	N

Sequences

Protein ID	Family	RBS	Sequence
MAnammox_158480	F061392	N/A	MPLQTFASGLDEPDPAFKLAAALSPIDGGELYVGNVDRDKKTFRLHLRHIGKNSKWVYYYASASAFVNEDGDVEPDNAVASLVYPQYTASVIGNTFRKARVRILFSPRGDGKGFFKEAGHVIFQECATKTFEAKNWKCTGWEYLGTLPGFE