2017108002: Bioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment

Overview

Basic Information

• IMG/M Taxon OID: 2017108002
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0045254 | Gp0051386 | Ga0025779
• Sample Name: Bioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 20878222
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Bioreactor Anammox Bacterial Community From Nijmegen, The Netherlands
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Nutrient Removal → Nitrogen Removal → Anammox → Bioreactor → Bioreactor Anammox Bacterial Community From Nijmegen, The Netherlands

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Nijmegen, The Netherlands
• Coordinates
  • Lat. (^o): 51.842
  • Long. (^o): 5.858
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061392	Metagenome / Metatranscriptome	132	N

Associated Scaffolds

Scaffold	Taxonomy	Length
MAnammo_C2172	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae	8539

Sequences

Scaffold ID	Protein ID	Family	Sequence
MAnammo_C2172	MAnammox_158480	F061392	MPLQTFASGLDEPDPAFKLAAALSPIDGGELYVGNVDRDKKTFRLHLRHIGKNSKWVYYYASASAFVNEDGDVEPDNAVASLVYPQYTASVIGNTFRKARVRILFSPRGDGKGFFKEAGHVIFQECATKTFEAKNWKCTGWEYLGTLPGFE