| Basic Information | |
|---|---|
| Taxon OID | 2016842003 Open in IMG/M |
| Scaffold ID | YNP16_C8254 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP16 Fairy Spring Red Layer |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1344 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, WY | |||||||
| Coordinates | Lat. (o) | 44.533365 | Long. (o) | -110.849887 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076975 | Metagenome / Metatranscriptome | 117 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| YNP16_293640 | F076975 | N/A | MMDGVGGYHRVGDSNYFGAAPALFCGQRGGNLRAEVIPSYSAADIARPAETVLVVEALSFEYGMTCRLRVPAPKDAVDASSPYYGLNYAPRLLGEYQTRNGYRYREGQGFVVCADGHPRRIFHTEQLFMINHRADGAPYYRMQYARE |
| ⦗Top⦘ |