Basic Information | |
---|---|
Taxon OID | 2014642005 Open in IMG/M |
Scaffold ID | 2014696691 Open in IMG/M |
Source Dataset Name | Marine plankton microbial communities from Ionian Km3 Station |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 843 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Deep Mediterranean Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mediterranean Sea, Ionian Km3 Station | |||||||
Coordinates | Lat. (o) | 36.4999 | Long. (o) | 15.693611 | Alt. (m) | Depth (m) | 3010 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026397 | Metagenome | 198 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2014721838 | F026397 | N/A | LFLTSLFFIFSCADITFYRKPIISVTISSDCHDLYEDNNLYIYISRLGTDWDSDMYVDVGNTEDLAVFVEGKYNITATATSEDSTASNYESIKSIYVYHGEERNVEFDCD |
⦗Top⦘ |