Basic Information | |
---|---|
IMG/M Taxon OID | 2014642005 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056647 | Gp0051214 | Ga0011163 |
Sample Name | Marine plankton microbial communities from Ionian Km3 Station |
Sequencing Status | Permanent Draft |
Sequencing Center | |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 7203198 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Plankton Microbial Communities From The Deep Mediterranean Sea |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Deep Mediterranean Sea |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → planktonic material |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Mediterranean Sea, Ionian Km3 Station | |||||||
Coordinates | Lat. (o) | 36.4999 | Long. (o) | 15.693611 | Alt. (m) | N/A | Depth (m) | 3010 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026397 | Metagenome | 198 | N |
F041257 | Metagenome / Metatranscriptome | 160 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2014696691 | Not Available | 843 | Open in IMG/M |
2014698868 | Not Available | 819 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
2014696691 | 2014721838 | F026397 | LFLTSLFFIFSCADITFYRKPIISVTISSDCHDLYEDNNLYIYISRLGTDWDSDMYVDVGNTEDLAVFVEGKYNITATATSEDSTASNYESIKSIYVYHGEERNVEFDCD |
2014698868 | 2014725015 | F041257 | MQEFKPNYRPLGSEEDDVVDPRSEQPDGPFDHERFKTLTVLAHAAGQVMDRYAIKGFEGFTNRQANWACKLQSFFNLSNPFETLVLLLFTFQFSRNERFDLEMGKTEPIDRSHPLSKALMAWVWWDPSSEASCVDRFYPWEYGKERTSRMVAIASGLLPEPIDVTSSGDIPPSPPRTQ |
⦗Top⦘ |