NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2014642005

2014642005: Marine plankton microbial communities from Ionian Km3 Station



Overview

Basic Information
IMG/M Taxon OID2014642005 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0056647 | Gp0051214 | Ga0011163
Sample NameMarine plankton microbial communities from Ionian Km3 Station
Sequencing StatusPermanent Draft
Sequencing Center
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size7203198
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Plankton Microbial Communities From The Deep Mediterranean Sea
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Deep Mediterranean Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodyplanktonic material
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationMediterranean Sea, Ionian Km3 Station
CoordinatesLat. (o)36.4999Long. (o)15.693611Alt. (m)N/ADepth (m)3010
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026397Metagenome198N
F041257Metagenome / Metatranscriptome160N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
2014696691Not Available843Open in IMG/M
2014698868Not Available819Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
20146966912014721838F026397LFLTSLFFIFSCADITFYRKPIISVTISSDCHDLYEDNNLYIYISRLGTDWDSDMYVDVGNTEDLAVFVEGKYNITATATSEDSTASNYESIKSIYVYHGEERNVEFDCD
20146988682014725015F041257MQEFKPNYRPLGSEEDDVVDPRSEQPDGPFDHERFKTLTVLAHAAGQVMDRYAIKGFEGFTNRQANWACKLQSFFNLSNPFETLVLLLFTFQFSRNERFDLEMGKTEPIDRSHPLSKALMAWVWWDPSSEASCVDRFYPWEYGKERTSRMVAIASGLLPEPIDVTSSGDIPPSPPRTQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.