| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2014642005 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056647 | Gp0051214 | Ga0011163 |
| Sample Name | Marine plankton microbial communities from Ionian Km3 Station |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 7203198 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Plankton Microbial Communities From The Deep Mediterranean Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Deep Mediterranean Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → planktonic material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mediterranean Sea, Ionian Km3 Station | |||||||
| Coordinates | Lat. (o) | 36.4999 | Long. (o) | 15.693611 | Alt. (m) | N/A | Depth (m) | 3010 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026397 | Metagenome | 198 | N |
| F041257 | Metagenome / Metatranscriptome | 160 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2014696691 | Not Available | 843 | Open in IMG/M |
| 2014698868 | Not Available | 819 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| 2014696691 | 2014721838 | F026397 | LFLTSLFFIFSCADITFYRKPIISVTISSDCHDLYEDNNLYIYISRLGTDWDSDMYVDVGNTEDLAVFVEGKYNITATATSEDSTASNYESIKSIYVYHGEERNVEFDCD |
| 2014698868 | 2014725015 | F041257 | MQEFKPNYRPLGSEEDDVVDPRSEQPDGPFDHERFKTLTVLAHAAGQVMDRYAIKGFEGFTNRQANWACKLQSFFNLSNPFETLVLLLFTFQFSRNERFDLEMGKTEPIDRSHPLSKALMAWVWWDPSSEASCVDRFYPWEYGKERTSRMVAIASGLLPEPIDVTSSGDIPPSPPRTQ |
| ⦗Top⦘ |