Basic Information | |
---|---|
Taxon OID | 2014642004 Open in IMG/M |
Scaffold ID | 2014692460 Open in IMG/M |
Source Dataset Name | Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 7_Deep_abyss_4000m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1041 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hawaii Ocean Time Series, North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 22.45 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 4000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041242 | Metagenome / Metatranscriptome | 160 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2014715728 | F041242 | AGG | MGKTRKATWQDHHDGASFTEESVWQAIADAEGLDYSDIADGDLVDWL |
⦗Top⦘ |