Scaffold 2014683963

Overview

Basic Information

• Taxon OID: 2014642004
• Scaffold ID: 2014683963
• Source Dataset Name: Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 7_Deep_abyss_4000m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 978
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha)

Source Dataset Sampling Location

• Location Name: Hawaii Ocean Time Series, North Pacific Ocean
• Coordinates
  • Lat. (^o): 22.45
  • Long. (^o): -158.0
  • Depth (m): 4000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001651	Metagenome / Metatranscriptome	657	Y

Sequences

Protein ID	Family	RBS	Sequence
2014703046	F001651	GGA	MTIAGKPIPEGGYIVALQNGKKIALAQRRHRVIQAKIEGRSEAEIAEQEGVAQYTVWKDIRAYLGEVRREDKAAVQAEYDLQRARYERLLLRWWDQAIGEDSDHAARATGIVLDILRRLDTIGGLIPEKPLIQFQQQNVMAGGVTFADLVREEMDGAGQGVEVVGLACDNVDPG