NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2014664747

Scaffold 2014664747


Overview

Basic Information
Taxon OID2014642002 Open in IMG/M
Scaffold ID2014664747 Open in IMG/M
Source Dataset NameMarine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 5_Below_upper_mesopelagic_500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)961
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha)

Source Dataset Sampling Location
Location NameHawaii Ocean Time Series, North Pacific Ocean
CoordinatesLat. (o)22.45Long. (o)-158.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012125Metagenome283Y

Sequences

Protein IDFamilyRBSSequence
2014674338F012125N/AMLDTCYNVMKPDSGRKSFFSAGKPKNLPAFYFLVVTGIILMVLLFKWFD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.