Basic Information | |
---|---|
Taxon OID | 2014642002 Open in IMG/M |
Scaffold ID | 2014664747 Open in IMG/M |
Source Dataset Name | Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 5_Below_upper_mesopelagic_500m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 961 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hawaii Ocean Time Series, North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 22.45 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 500 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012125 | Metagenome | 283 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2014674338 | F012125 | N/A | MLDTCYNVMKPDSGRKSFFSAGKPKNLPAFYFLVVTGIILMVLLFKWFD |
⦗Top⦘ |