Scaffold PLMO_FPCF1403_b1

Overview

Basic Information

• Taxon OID: 2013843001
• Scaffold ID: PLMO_FPCF1403_b1
• Source Dataset Name: Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Morges-2007 (PGA)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 785
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools → Activated Sludge Microbial Communities From Commune De Morges, Switzerland

Source Dataset Sampling Location

• Location Name: Bief, Commune de Morges, Canton Vaud, Switzerland
• Coordinates
  • Lat. (^o): 46.51668
  • Long. (^o): 6.510145
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021450	Metagenome	219	N

Sequences

Protein ID	Family	RBS	Sequence
PLMO_210060	F021450	N/A	MKKVISFLALFMLISIEMQAQVTNVLNNFYSVWVKPAIPIVAGLVLIVGALANMGKVLGESRDYKGFAQGIVLYLAVYLCVVAIVSYIMAG