Scaffold YNP8_FUBN26297_b2

Overview

Basic Information

• Taxon OID: 2013515001
• Scaffold ID: YNP8_FUBN26297_b2
• Source Dataset Name: Hot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - YNP8 OSP Spring
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 766
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, WY
• Coordinates
  • Lat. (^o): 44.733519
  • Long. (^o): -110.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058699	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
YNP8_245300	F058699	N/A	IEEENEPYRRLTIEWYKDLETGIFLAKLTVEGEGIKEGKREAVFTLSSDRIDDVDLLNPSELVEKLMLNSDSLNDLINYIGGDLIRSTLGNLNSMSVADYLIYFFIKMLAEVIAKGVIILDANKLKMSLSGEKS