| Basic Information | |
|---|---|
| Taxon OID | 2010549000 Open in IMG/M |
| Scaffold ID | RicEn_FSXC3319_g1 Open in IMG/M |
| Source Dataset Name | Rice endophytes microbial communities from Berkeley, California, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 798 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Endophytes → Unclassified → Rice Endophytes → Rice Endophytes Microbial Communities From The International Rice Research Institute, Philippines |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Philippines: Los Banos | |||||||
| Coordinates | Lat. (o) | 14.1677 | Long. (o) | -121.2523 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080249 | Metagenome / Metatranscriptome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| RicEn_196220 | F080249 | N/A | MIDATQRETPMTDNKQNKGTPDRNLISFKQKYEFDYAVKQLQKQIPDTTRQEAKDALAAAAKKISPSEGREKIMRAARKTLRD |
| ⦗Top⦘ |