| Basic Information | |
|---|---|
| Taxon OID | 2010170001 Open in IMG/M |
| Scaffold ID | BISONR_C3579 Open in IMG/M |
| Source Dataset Name | 3_050719R |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2743 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → unclassified Microcoleus → Microcoleus sp. FACHB-672 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bison Pool / Rosette Geyser, Yellowstone National Park | |||||||
| Coordinates | Lat. (o) | 44.6 | Long. (o) | -110.9 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028182 | Metagenome / Metatranscriptome | 192 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BISONR_100540 | F028182 | GAG | MPKVSISEAARRLETTEEVIREWIRLGLLDVELPSAKPRRTRELNPAFQPTSATPEPNVDLEQLYQ |
| ⦗Top⦘ |