Scaffold bisonPool14jan08_C11910

Overview

Basic Information

• Taxon OID: 2009439000
• Scaffold ID: bisonPool14jan08_C11910
• Source Dataset Name: 2_050719S
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1392
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients

Source Dataset Sampling Location

• Location Name: Bison Pool / Rosette Geyser, Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.5696298
  • Long. (^o): -110.8651817

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075483	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
BISONS_30392	F075483	AGAAG	MIELLAVQAITTAALAFFVIKLRRELWPVVATAGPAYASFWVRSVDVLVLAGPQFEIGKSVVRVRWAFTEELFLRHRLRVYDVAMHPHCHHHYAMWRAWLNGDSRYECEVEKPRGLARLYTKAIDVFCKEKEPPKEVEIIPTWARKRRYKRMLRQLREDAARRRSAEKPNK