| Basic Information | |
|---|---|
| Taxon OID | 2008193000 Open in IMG/M |
| Scaffold ID | 2008202623 Open in IMG/M |
| Source Dataset Name | Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 830 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Palmer Station B, Arthur Harbor, Antarctic Peninsula | |||||||
| Coordinates | Lat. (o) | -64.766667 | Long. (o) | -64.05 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035964 | Metagenome / Metatranscriptome | 171 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2008204475 | F035964 | N/A | ENQLVVNNGKLVVATAKVPTAKVPTAKKVVKFREIFGIRLGAKPSIELRTAVKVLKANSERSNMTFNYILSEYKKEMIRNDKKTDGKNFEGRLRRILYRSIESGITRESIQGIKFNLNANYKGIKVITSQPFIFNNSANVARKDVEENLYTFKFNKVVTLINKAEIKTVSDKVKAFKTLI |
| ⦗Top⦘ |