Scaffold 2008197071

Overview

Basic Information

• Taxon OID: 2008193000
• Scaffold ID: 2008197071
• Source Dataset Name: Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 775
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → unclassified Oceanospirillaceae → Oceanospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Source Dataset Sampling Location

• Location Name: Palmer Station B, Arthur Harbor, Antarctic Peninsula
• Coordinates
  • Lat. (^o): -64.766667
  • Long. (^o): -64.05
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062189	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
2008198698	F062189	N/A	EQQLRQPFCKRAMRFSKEGYAALMNTKRMLETKLERPISESVALNMVLLGESLA