Scaffold 2006871113

Overview

Basic Information

• Taxon OID: 2006543006
• Scaffold ID: 2006871113
• Source Dataset Name: Marine microbial communities from anoxic basin of Saanich Inlet - SI040908_100
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1035
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Anoxic Basin Of Saanich Inlet In Vancouver, Canada

Source Dataset Sampling Location

• Location Name: Saanich Inlet, British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.616667
  • Long. (^o): -123.5
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036928	Metagenome / Metatranscriptome	169	N

Sequences

Protein ID	Family	RBS	Sequence
2007017314	F036928	N/A	MYSKLGYLIKALKETNEKSEDIMTAKGKYQYPRRFWEGVKKGYNGN