| Basic Information | |
|---|---|
| Family ID | F036928 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MYSKLGYLIKALKETNERDEDIRTAKGKYQYPRTLIEALGKWQ |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 32.54 % |
| % of genes near scaffold ends (potentially truncated) | 36.69 % |
| % of genes from short scaffolds (< 2000 bps) | 73.37 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.071 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (21.302 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.047 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.290 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 62.79% β-sheet: 0.00% Coil/Unstructured: 37.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF14550 | Peptidase_S78_2 | 5.33 |
| PF04466 | Terminase_3 | 1.78 |
| PF01541 | GIY-YIG | 0.59 |
| PF07460 | NUMOD3 | 0.59 |
| PF03237 | Terminase_6N | 0.59 |
| PF05065 | Phage_capsid | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 1.78 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.07 % |
| All Organisms | root | All Organisms | 47.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.30% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.47% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.47% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.92% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 5.33% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.33% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.73% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.73% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.55% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.96% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.37% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.78% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.78% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.78% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.78% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.18% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.18% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.18% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.18% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.18% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.59% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.59% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.59% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.59% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.59% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.59% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.59% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.59% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.59% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.59% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.59% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.59% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.59% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.59% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.59% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2006543006 | Marine microbial communities from anoxic basin of Saanich Inlet - SI040908_100 | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000118 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300003410 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019745 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024281 | Seawater microbial communities from Monterey Bay, California, United States - 11D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028414 | Seawater microbial communities from Monterey Bay, California, United States - 33D | Environmental | Open in IMG/M |
| 3300031227 | Saline water microbial communities from Ace Lake, Antarctica - #232 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2007017314 | 2006543006 | Marine | MYSKLGYLIKALKETNEKSEDIMTAKGKYQYPRRFWEGVKKGYNGN |
| DelMOSum2010_1000480415 | 3300000101 | Marine | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALGKWR* |
| DelMOSum2010_100435592 | 3300000101 | Marine | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLIEALGKWQ* |
| DelMOSpr2010_100055102 | 3300000116 | Marine | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTLKEALGKWR* |
| DelMOSpr2010_100342113 | 3300000116 | Marine | MYSKLGYLIKALKETNERDEDVRTAKGKYQYPRTLIEALGKWQ* |
| DelMOSpr2010_100365034 | 3300000116 | Marine | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLTEALGKW |
| DelMOSpr2010_100380861 | 3300000116 | Marine | IKALKETNERDEDIKIAKGKYQYPRTLTEALGKWQ* |
| DelMOSpr2010_100598822 | 3300000116 | Marine | MYSKLGYLIKALKETNERDEXIKIAKGKYQYPRTLIEALGKWQ* |
| DelMOSpr2010_101074521 | 3300000116 | Marine | KALKETNERDEDIKIAKGKYQYPRTLTEALGKWQ* |
| TDF_OR_ARG05_123mDRAFT_10074872 | 3300000118 | Marine | MLSKLGYLIKALKETNEKDEDINTAKGKYQYPRTLKEAIGKWQ* |
| TDF_OR_ARG04_113mDRAFT_10180362 | 3300000121 | Marine | MYSKLGYLIKALKETNEKNEDVMIAKGKYQYPRTLIEALGKWQ* |
| JGI11705J14877_100892802 | 3300001419 | Saline Water And Sediment | MYSKLGYLIKALKETNERDEDVRTAKGKYQYPRTLKEALGKWQ* |
| GOS2218_10225711 | 3300001947 | Marine | MYSKLGYLIKALKDTNERDEDIKTAKGKYQYPRTLIEALGKWQ* |
| GOS2218_10434282 | 3300001947 | Marine | MYSKLGYLIKALKETNKKNEDVRTAKGKYQYPRTLIEALGKWQ* |
| GOS2229_10524552 | 3300001963 | Marine | MYSQLGYLIKALKETNERDEDISTAKGKYQYPRTFKEALGKWR* |
| JGI26086J50260_10096756 | 3300003410 | Marine | MYSKLGYLIKALKETNEKNEDVRIAKGKYQYPRTLKEALGKWR* |
| JGI26084J50262_10240882 | 3300003427 | Marine | MYSKLGYLIKALKETNEKNEDVRIAKGKYQYPRTLKEALGKWQ* |
| JGI26084J50262_10544232 | 3300003427 | Marine | MYSRLGYLIKALKETNEKNEDIKIAKGKYQYPRTLIEALGKWQ* |
| JGI26083J51738_100596142 | 3300003621 | Marine | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLKEALGKWQ* |
| Ga0066605_101466462 | 3300004279 | Marine | MYSRLGYLIKALKETNDKSEDVRIAKGKYQYPRTLIEALGKWQ* |
| Ga0065726_133853 | 3300004369 | Saline | MYSKLGYLIKALKETNERDEDIKVAKGKYQYPRTLIEALGKWR* |
| Ga0065861_10126543 | 3300004448 | Marine | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTFFEGLKKGYYGG* |
| Ga0065861_10480562 | 3300004448 | Marine | MYSKLGYLIKALKETNERDEDIKTAKGKYQYPRTLIEALGKWQ* |
| Ga0066222_10295363 | 3300004460 | Marine | LGYLIKALKETNERDEDIKIAKGKYQYPRTFFEGLKKGYYGG* |
| Ga0068515_1071382 | 3300004829 | Marine Water | MYSKLGYLIKALKETNDKSEDVLIAKGKYQYPKTLKEALGKWR* |
| Ga0068513_10184822 | 3300004951 | Marine Water | LKWNCSTMYSQLGYLIKALKETNDKSEDVLIAKGKYQSPRTFWEGVKKGYNGD* |
| Ga0073579_11462202 | 3300005239 | Marine | MYSKLGYLIKALKETNEKNEDVRTAKGKYQYPRTLIEALGKWQ* |
| Ga0073579_11881958 | 3300005239 | Marine | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTIKEAFGKWR* |
| Ga0074648_11056871 | 3300005512 | Saline Water And Sediment | GYLIKALKETNERDEDVRTAKGKYQYPRTLKEALGKWQ* |
| Ga0076924_12108701 | 3300005747 | Marine | LGYLIKALKETNERDEDITTAKGKYQYPRTLIEALGKWQ* |
| Ga0075474_100382032 | 3300006025 | Aqueous | MYSQLGYLIKALKETTERDEDIRTAKGKYQYPRTIKEALGKWR* |
| Ga0075474_101475162 | 3300006025 | Aqueous | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLTEALGKWQ* |
| Ga0075478_100941292 | 3300006026 | Aqueous | KWNYSTMYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALGKWR* |
| Ga0075462_101200362 | 3300006027 | Aqueous | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLIEALGKWQ* |
| Ga0075466_11120622 | 3300006029 | Aqueous | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLIEALGKWQ* |
| Ga0075441_101385662 | 3300006164 | Marine | MLSKLGYLIKALKETNEKDEDINTAKGKYQYPRTFKEAIGKWQ* |
| Ga0075447_102078662 | 3300006191 | Marine | MLSKLGYLIKALKETNEKNEDVIIAKGKYQYPRTFIEGLKKGYYGD* |
| Ga0075461_100998062 | 3300006637 | Aqueous | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLTEALGKWQ* |
| Ga0098073_10069221 | 3300006734 | Marine | MYSKLGYLIKALKETEQRDEDILIAKGKYQYPRTFWDGVKKGYNGN* |
| Ga0098073_10156741 | 3300006734 | Marine | MYSKLGYLIKALKETEQRDEDILIAKGKYQYPRTLKEALGKWR* |
| Ga0098073_10202782 | 3300006734 | Marine | MYSKLGYLIKALKETNDKSEDVLIAKGKYQYPRTLKEALGKWR* |
| Ga0098038_11793382 | 3300006735 | Marine | MYSKLGYLIKALKETNEKNEDVRIAKGKYQYPRTLIEALGKWQ* |
| Ga0098074_11219321 | 3300006790 | Marine | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTF |
| Ga0098055_10423562 | 3300006793 | Marine | MYSKLGYLIKALKETNEKSEDVRTAKGKYQYPRTLIEALGKWQ* |
| Ga0098055_11395011 | 3300006793 | Marine | MYSKLGYLIKALKETNEKSEDIMTAKGKYQYPRTLIEALGK |
| Ga0098055_11896822 | 3300006793 | Marine | MYSQLGYLIKALKETNKRDEDIRTAKGKYQYPRTLKEALGKWR* |
| Ga0070749_104100961 | 3300006802 | Aqueous | LGYLIKALKETNERDEDITTAKGKYQYPRTLKEALSKWR* |
| Ga0070749_105570872 | 3300006802 | Aqueous | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLKEALGKWR* |
| Ga0075467_105413412 | 3300006803 | Aqueous | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTFFEGLKKGYYGD* |
| Ga0070754_100567442 | 3300006810 | Aqueous | MYSQLGYLIKALKETTERDEDIRTAKGKYQYPRTIKEALSKWR* |
| Ga0070754_103134281 | 3300006810 | Aqueous | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLI |
| Ga0070754_103813832 | 3300006810 | Aqueous | MYSQLGYLIKALKETNDKSEDVLIAKGKYQYPRTLKEALGKWR* |
| Ga0070750_103217412 | 3300006916 | Aqueous | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTFWDGVKKGYNGN* |
| Ga0098050_11115592 | 3300006925 | Marine | MYSQLGYLIKALKETNERDEVIRTAKGKYQYPRTLKEALGKWR* |
| Ga0070745_10775531 | 3300007344 | Aqueous | YSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLTEALGKWR* |
| Ga0070753_10953002 | 3300007346 | Aqueous | LIKALKETNERDEDIKIAKGKYQYPRTLTEALGKWQ* |
| Ga0099851_10440021 | 3300007538 | Aqueous | SKLGYLIKALKETNERDEDITTAKGKYQYPRTLKEALGKWR* |
| Ga0099847_12298512 | 3300007540 | Aqueous | MYSKLGYLIKALKETNEKNEDVNTAKGKYQYPRTLIEALGKWQ* |
| Ga0102945_10410592 | 3300007609 | Pond Water | MYSKLGYLIKALKETNETSEDIKIAKGKYQYPRTIIEALSKWQ* |
| Ga0102951_11749462 | 3300007725 | Water | MYSKLGYLIKALKETNETSEDIKIAKGKYQYPRTLKEALGKWR* |
| Ga0102954_12024722 | 3300007778 | Water | LGYLIKALKETNERDEDIKIAKGKYQYPRTLIEALGKWQ* |
| Ga0075480_101389642 | 3300008012 | Aqueous | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTFKEALGKWR* |
| Ga0114916_10995702 | 3300008221 | Deep Ocean | MYSKLGYLIKALKETNEKNEDVIIAKGKYQYPRTFIEGLKKGYYGD* |
| Ga0102960_11565792 | 3300009000 | Pond Water | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTFIEALGKWQ* |
| Ga0115549_11780772 | 3300009074 | Pelagic Marine | MYSKLGYLIKALKETNERDEDVRTAKGKYQYPRTFLEGVKKGYYGD* |
| Ga0118687_102888362 | 3300009124 | Sediment | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLKEALSKWQ* |
| Ga0114918_100189485 | 3300009149 | Deep Subsurface | MYSKLGYLIKALKETNEKDEDIRIAKGKYQYPRTLIEALGKWQ* |
| Ga0115548_11897691 | 3300009423 | Pelagic Marine | MYSKLGYLIKALKETNERDEDVRTAKGKYQYPRTFFEGVKKGYYGD* |
| Ga0115545_11642432 | 3300009433 | Pelagic Marine | GYLIKALKETNERDEDVRTAKGKYQYPRTFFEGVKKGYYGD* |
| Ga0115571_14404672 | 3300009495 | Pelagic Marine | KLGYLIKALKETNERDEDVRTAKGKYQYPRTLKEALGKWQ* |
| Ga0098056_12474222 | 3300010150 | Marine | MYSKLGYLIKALKETNEKSEDIMTAKGKYQYPRTLIEALGKWQ* |
| Ga0129345_10377101 | 3300010297 | Freshwater To Marine Saline Gradient | QVRHKWNYSTMYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALGKWR* |
| Ga0129345_13020531 | 3300010297 | Freshwater To Marine Saline Gradient | KWNYSTMYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFWEGVKKGYNNGD* |
| Ga0136656_11918491 | 3300010318 | Freshwater To Marine Saline Gradient | VRLKWNYSTMYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALGKWR* |
| Ga0129324_100745502 | 3300010368 | Freshwater To Marine Saline Gradient | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLTEALGKWR* |
| Ga0136549_101003362 | 3300010389 | Marine Methane Seep Sediment | MYSRLGYLIKALKETNEKDEDIKIAKGKYQYPRTLIEALGKWQ* |
| Ga0129327_102977011 | 3300013010 | Freshwater To Marine Saline Gradient | STMYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLKEALGKWR* |
| Ga0180120_101723872 | 3300017697 | Freshwater To Marine Saline Gradient | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLTEA |
| Ga0181412_10054183 | 3300017714 | Seawater | MYSQLGYLIKALKETNERDEDIKTAKGRYQYPRTFKEALGKWR |
| Ga0181390_11661412 | 3300017719 | Seawater | MYSKLGYLIKALKETNEKNEDVSIAKGKYQYPRTLIEALGKWQ |
| Ga0181401_10056524 | 3300017727 | Seawater | MYSRLGYLIKALKETNDKSEDVRIAKGKYQYPRTLIEALGKWQ |
| Ga0181400_10234411 | 3300017752 | Seawater | MYSKLGYLIKALKETNEKNEDVRIAKGKYQYPRTLKEA |
| Ga0181379_12547272 | 3300017783 | Seawater | MYSKLGYLIKALKETNEKNEDVRIAKGKYQYPRTLIEALGKW |
| Ga0181552_101480712 | 3300017824 | Salt Marsh | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLKEALSKWQ |
| Ga0181580_101262222 | 3300017956 | Salt Marsh | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLKEALSKWQ |
| Ga0181571_104913322 | 3300017957 | Salt Marsh | IKALKETNERDEDIKIAKGKYQYPRTLKEALSKWQ |
| Ga0181571_105209292 | 3300017957 | Salt Marsh | MYSQLGYLIKALKETNDKSEDVLIAKGKYQYPRTLKEALGKWR |
| Ga0181581_100039022 | 3300017962 | Salt Marsh | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLKEALSKWR |
| Ga0181589_103816401 | 3300017964 | Salt Marsh | LGYLIKALKETNERDEDIKIAKGKYQYPRTLKEALSKWR |
| Ga0181590_101546092 | 3300017967 | Salt Marsh | YLIKALKETNERDEDIKIAKGKYQYPRTLKEALSKWR |
| Ga0181559_101009851 | 3300018415 | Salt Marsh | MYSKLGYLIKALKETNERDEDIKVAKGKYQYPRTLKEALSKWQ |
| Ga0181559_104108442 | 3300018415 | Salt Marsh | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTFFEGLKKGYYGD |
| Ga0181591_104844942 | 3300018424 | Salt Marsh | MYSRLGYLIKALKETNEKDEDIKIAKGKYQYPRTLIEALGKWQ |
| Ga0181562_101078362 | 3300019459 | Salt Marsh | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLIEALGKWQ |
| Ga0181562_104750921 | 3300019459 | Salt Marsh | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTFFEG |
| Ga0194002_11046852 | 3300019745 | Sediment | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALGKWR |
| Ga0194024_10139182 | 3300019765 | Freshwater | VRHKWNYSTMYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALGKWR |
| Ga0206128_12897572 | 3300020166 | Seawater | FIKALKETNERDEDVRTAKGKYQYPRTFFEGVKKGYYGD |
| Ga0206127_11797061 | 3300020169 | Seawater | MYSKLGYLIKALKETNEKNEDVRTAKGKYQYPRTLIEALGKWQ |
| Ga0181599_11860482 | 3300020178 | Salt Marsh | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTFWDGVKKGYNGN |
| Ga0206130_100190125 | 3300020187 | Seawater | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLKEALGKWR |
| Ga0206677_100091675 | 3300021085 | Seawater | MYSKLGYLIKALKETNEKSEDIMTAKGKYQYPRTLIEALGKWQ |
| Ga0206687_10740562 | 3300021169 | Seawater | MYSKLGYLIKALKETNEKSEEIMTAKGKYQYPRTLIEALGKWQ |
| Ga0213867_10688372 | 3300021335 | Seawater | MYSQLGYLIKALKETRLKDEDVLIAKGKYQYPRTIKEALGKWQ |
| Ga0206692_12665522 | 3300021350 | Seawater | MYSKLGYLIKALKETNEKNEDVRIAKGKYQYPRTLIEALGKWQ |
| Ga0213865_101079552 | 3300021373 | Seawater | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFK |
| Ga0213865_101908372 | 3300021373 | Seawater | RLKWNYSTMYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALGKWR |
| Ga0213861_100335252 | 3300021378 | Seawater | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLTEALGKWQ |
| Ga0213868_100626983 | 3300021389 | Seawater | LKWNCSTMYSRLGYLIKALKETNDKSEDVRIAKGKYQYPRTLIEALGKWQ |
| Ga0213868_100753472 | 3300021389 | Seawater | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLIEALGKWQ |
| Ga0222718_100253572 | 3300021958 | Estuarine Water | MYSKLGYLIKALKETNQKDEDIKIAKGKYQYPRTLIEALGKWQ |
| Ga0212030_10435572 | 3300022053 | Aqueous | MYSKLGYLIKALKETNEKNEDVNTAKGKYQYPRTLIEALGKWQ |
| Ga0212024_10095512 | 3300022065 | Aqueous | KLGYLIKALKETNERDEDIKIAKGKYQYPRTLIEALGKWQ |
| Ga0196903_10247612 | 3300022169 | Aqueous | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTL |
| Ga0196887_11087302 | 3300022178 | Aqueous | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLIEA |
| Ga0196891_10433321 | 3300022183 | Aqueous | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFWEGVKKGYNNGN |
| Ga0196899_10181312 | 3300022187 | Aqueous | MYSQLGYLIKALKETTERDEDIRTAKGKYQYPRTIKEALGKWR |
| Ga0196901_11956202 | 3300022200 | Aqueous | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLTEALGKWR |
| Ga0255773_103003062 | 3300022925 | Salt Marsh | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLK |
| Ga0255753_12182892 | 3300022926 | Salt Marsh | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLKEA |
| (restricted) Ga0233412_104291071 | 3300023210 | Seawater | LIKALKETNEKNEDVRIAKGKYQYPRTLKEALGKWQ |
| (restricted) Ga0255040_100042465 | 3300024059 | Seawater | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALG |
| (restricted) Ga0255040_102040122 | 3300024059 | Seawater | MYSQLGYLIKALKETNEKNEDVRIAKGKYQYPRTLKEALGKWQ |
| (restricted) Ga0255039_100160061 | 3300024062 | Seawater | STMYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALGKWR |
| Ga0210003_10242062 | 3300024262 | Deep Subsurface | MYSKLGYLIKALKETNEKDEDIRIAKGKYQYPRTLIEALGKWQ |
| (restricted) Ga0233444_100397113 | 3300024264 | Seawater | MYSKLGYLIKALKETNEKNEDVRIAKGKYQYPRTLKEALGKWQ |
| Ga0228610_10215402 | 3300024281 | Seawater | MYSQLGYLINALKETNERDEDIRTAKGKYQYPRTFKEALGKWR |
| Ga0244775_108188322 | 3300024346 | Estuarine | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLI |
| (restricted) Ga0255047_103288221 | 3300024520 | Seawater | MYSKLGYLIKALKETNEKNEDVRIAKGKYQYPRTLK |
| (restricted) Ga0255045_100370842 | 3300024528 | Seawater | MYSQLGYLINALKETNEKNEDVRIAKGKYQYPRTLKEALGKWQ |
| Ga0208018_1016113 | 3300025057 | Marine | MYSKLGYLIKALKETNDKSEDVLIAKGKYQYPRTLKEALGKWR |
| Ga0208018_1043532 | 3300025057 | Marine | MYSKLGYLIKALKETEQRDEDILIAKGKYQYPRTLKEALGKWR |
| Ga0208792_10220952 | 3300025085 | Marine | MYSKLGYLIKALKETKDKSEDVRTAKGKYQYPRTLKEALGKWR |
| Ga0208792_10241482 | 3300025085 | Marine | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTLKEALGKWR |
| Ga0208792_10771691 | 3300025085 | Marine | LQVRHKWNYSTMYSKLGYLIKALKETNEKNEDVRIAKGKYQYPRTLIEALGKWQ |
| Ga0208032_10088853 | 3300025266 | Deep Ocean | MLSKLGYLIKALKETNEKDEDINTAKGKYQYPRTLKEAIGKWQ |
| Ga0208032_10213782 | 3300025266 | Deep Ocean | MLSKLGYLIKALKETNEKDEDINTAKGKYQYPRTFKEAIGKWQ |
| Ga0208814_11113962 | 3300025276 | Deep Ocean | MLSKLGYLIKALKETNEKNEDVIIAKGKYQYPRTFIEGLKKGYYGD |
| Ga0208303_10551262 | 3300025543 | Aqueous | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLKEALGKWQ |
| Ga0209304_11025511 | 3300025577 | Pelagic Marine | YLIKALKETNERDEDVRTAKGKYQYPRTFFEGVKKGYYGD |
| Ga0209094_10261752 | 3300025594 | Pelagic Marine | YLIKALKETNERDEDVRTAKGKYQYPRTFLEGVKKGYYGD |
| Ga0209716_10434952 | 3300025626 | Pelagic Marine | MYSKLGYLIKALKETNERDEDVRTAKGKYQYPRTFFEGVKKGYYGD |
| Ga0209833_10265362 | 3300025641 | Pelagic Marine | MYSKLGYLIKALKETNERDEDVRTAKGKYQYPRTFLEGVKKGYYGD |
| Ga0208643_11161452 | 3300025645 | Aqueous | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTLIEALGKWQ |
| Ga0208160_10191671 | 3300025647 | Aqueous | LIKALKETNERDEDITTAKGKYQYPRTLKEALGKWR |
| Ga0208162_10267273 | 3300025674 | Aqueous | VRHKWNYSTMYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFWEGVKKGYNNGD |
| Ga0208162_10343403 | 3300025674 | Aqueous | HKWNYSTMYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKEALGKWR |
| Ga0209653_10491822 | 3300025695 | Marine | MYSRLGYLIKALKETNEKNEDIKIAKGKYQYPRTLIEALGKWQ |
| Ga0208899_10866052 | 3300025759 | Aqueous | NYSTMYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLTEALGKWQ |
| Ga0208425_10747792 | 3300025803 | Aqueous | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFWEGVKK |
| Ga0209603_10701782 | 3300025849 | Pelagic Marine | QVRHKWNYSTMYSKLGYLIKALKETNERDEDVRTAKGKYQYPRTLKEALGKWR |
| Ga0209757_101714032 | 3300025873 | Marine | MYSQLGYLIKALKETNDKSEDVMIAKGKYQYPRTLKEALGKWR |
| Ga0208544_103338961 | 3300025887 | Aqueous | MYSKLGYLIKALKETNERDEDITTAKGKYQYPRTFFEGLKKGYYGD |
| Ga0209929_10568802 | 3300026187 | Pond Water | MYSQLGYLIKALKETNDKSEDVLIAKGKYQYPRTLKEALGKWQ |
| (restricted) Ga0255041_101313781 | 3300027837 | Seawater | MYSQLGYLIKALKETNERDEDIRTAKGKYQYPRTFKE |
| (restricted) Ga0233415_100031683 | 3300027861 | Seawater | MYSKLGYLIKALKETNERDEDVRIAKGKYQYPRTLKEALGKWQ |
| (restricted) Ga0233415_100854102 | 3300027861 | Seawater | MYSKLGYLIKALKETNERDEDVRIAKGKYQYPRTLIEALGKWQ |
| Ga0209536_1023855802 | 3300027917 | Marine Sediment | MYSQLGYLIKALKETNERDEDIKIAKGKYQYPRTLKEALGKWR |
| Ga0233450_100568481 | 3300028115 | Salt Marsh | YSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLKEALSKWQ |
| Ga0256368_10697792 | 3300028125 | Sea-Ice Brine | MYSKLGYLIKALKETNERDEDIKTAKGKYQYPRTLIEALGKWQ |
| Ga0228627_10012232 | 3300028414 | Seawater | MYSQLGYLIKALKETNERDEDISTAKGKYQYPRTFKEALGKWR |
| Ga0307928_100692232 | 3300031227 | Saline Water | MLSKLGYLIKALKETNEKDEDTITAKGKYQYPRTFKESISKWQ |
| Ga0307380_100934702 | 3300031539 | Soil | MYSNLGYLIKALKETNERDEDIKTAKGKYQYPRTLIEALGKWQ |
| Ga0307380_105626701 | 3300031539 | Soil | GYLIKALKETNERDEDVRTAKGKYQYPRTLKEALGKWQ |
| Ga0307376_100171972 | 3300031578 | Soil | MYSKLGYLIKALKETNERDEDIRTAKGKYQYPRTLIEALGKWQ |
| Ga0307376_106847971 | 3300031578 | Soil | MYSKLGYLIKALKETNERDEDIKTAKGKYQYPRTLIE |
| Ga0348335_019725_3177_3287 | 3300034374 | Aqueous | MYSRLGYLIKALKETNERDEDIKIAKGKYQYPRTLTE |
| Ga0348335_032027_1_120 | 3300034374 | Aqueous | LGYLIKALKETNERDEDIKIAKGKYQYPRTLTEALGKWQ |
| Ga0348335_076151_1040_1150 | 3300034374 | Aqueous | MYSKLGYLIKALKETNERDEDIKIAKGKYQYPRTLTE |
| ⦗Top⦘ |