 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 2001200004 Open in IMG/M |
| Scaffold ID | 2001413554 Open in IMG/M |
| Source Dataset Name | Fossil microbial communities from Whale Fall, West Antarctic Peninsula - Bone |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 859 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Fossil → Whale Fall → Fossil → Fossil Microbial Community From Whale Fall, Santa Cruz Basin Of The Pacific Ocean And West Antarctic Peninsula |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Santa Cruz Basin, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -65.1 | Long. (o) | -64.47 | Alt. (m) | Depth (m) | 1670 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073087 | Metagenome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2001511754 | F073087 | AGGA | MNTQHQTSFTKAIIGSTQRLFRSNKNHSLLANSFINARTMKDIGVNPVGLN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |