NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105942

Metagenome / Metatranscriptome Family F105942

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105942
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 45 residues
Representative Sequence ADVTLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR
Number of Associated Samples 84
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 89.00 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(33.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.75%    β-sheet: 0.00%    Coil/Unstructured: 42.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF07238PilZ 5.00
PF01712dNK 4.00
PF01887SAM_HAT_N 3.00
PF07638Sigma70_ECF 3.00
PF12867DinB_2 3.00
PF08818DUF1801 2.00
PF00580UvrD-helicase 1.00
PF11999Ice_binding 1.00
PF00004AAA 1.00
PF04909Amidohydro_2 1.00
PF12969DUF3857 1.00
PF02357NusG 1.00
PF00069Pkinase 1.00
PF06452CBM9_1 1.00
PF08241Methyltransf_11 1.00
PF13505OMP_b-brl 1.00
PF07690MFS_1 1.00
PF07366SnoaL 1.00
PF00248Aldo_ket_red 1.00
PF04140ICMT 1.00
PF04389Peptidase_M28 1.00
PF01740STAS 1.00
PF01040UbiA 1.00
PF03601Cons_hypoth698 1.00
PF00027cNMP_binding 1.00
PF13545HTH_Crp_2 1.00
PF12680SnoaL_2 1.00
PF08281Sigma70_r4_2 1.00
PF14110DUF4282 1.00
PF13564DoxX_2 1.00
PF00106adh_short 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 4.00
COG1428Deoxyadenosine/deoxycytidine kinaseNucleotide transport and metabolism [F] 4.00
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 3.00
COG1912Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)Defense mechanisms [V] 3.00
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 2.00
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 2.00
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 2.00
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 1.00
COG0250Transcription termination/antitermination protein NusGTranscription [K] 1.00
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 1.00
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 1.00
COG3973DNA helicase IVReplication, recombination and repair [L] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.00 %
UnclassifiedrootN/A20.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_100912551All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300001593|JGI12635J15846_10648026All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300004479|Ga0062595_101692481All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300005174|Ga0066680_10077810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1997Open in IMG/M
3300005332|Ga0066388_102504857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus938Open in IMG/M
3300005439|Ga0070711_100239939All Organisms → cellular organisms → Bacteria → Acidobacteria1417Open in IMG/M
3300005445|Ga0070708_100590052All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1047Open in IMG/M
3300005467|Ga0070706_100890201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae822Open in IMG/M
3300005539|Ga0068853_100283248All Organisms → cellular organisms → Bacteria1528Open in IMG/M
3300005842|Ga0068858_102342081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae528Open in IMG/M
3300006047|Ga0075024_100497730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus638Open in IMG/M
3300006059|Ga0075017_101516914All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus528Open in IMG/M
3300006163|Ga0070715_11015073Not Available518Open in IMG/M
3300006794|Ga0066658_10587523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae606Open in IMG/M
3300006796|Ga0066665_11236238All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006903|Ga0075426_10433287Not Available972Open in IMG/M
3300006954|Ga0079219_10904470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae714Open in IMG/M
3300006954|Ga0079219_11530182Not Available606Open in IMG/M
3300007255|Ga0099791_10037307All Organisms → cellular organisms → Bacteria → Acidobacteria2149Open in IMG/M
3300007265|Ga0099794_10533672All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300009089|Ga0099828_10277918All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300009090|Ga0099827_11489048All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300010048|Ga0126373_10268879All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300010320|Ga0134109_10485492Not Available508Open in IMG/M
3300010358|Ga0126370_10042363All Organisms → cellular organisms → Bacteria2838Open in IMG/M
3300010358|Ga0126370_10390447Not Available1140Open in IMG/M
3300010359|Ga0126376_12395333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300010361|Ga0126378_11667816All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300010362|Ga0126377_11717925All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300010364|Ga0134066_10204788All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300010376|Ga0126381_100478512All Organisms → cellular organisms → Bacteria → Acidobacteria1752Open in IMG/M
3300010376|Ga0126381_101126342All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300010376|Ga0126381_103735736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia595Open in IMG/M
3300011269|Ga0137392_11568282All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300011269|Ga0137392_11637972Not Available501Open in IMG/M
3300012189|Ga0137388_11163459All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012205|Ga0137362_11797892All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012362|Ga0137361_10062748All Organisms → cellular organisms → Bacteria3115Open in IMG/M
3300012362|Ga0137361_10856805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae825Open in IMG/M
3300012363|Ga0137390_11027505All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300012925|Ga0137419_10158372All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300012929|Ga0137404_10094525All Organisms → cellular organisms → Bacteria → Acidobacteria2398Open in IMG/M
3300012929|Ga0137404_12013275Not Available539Open in IMG/M
3300012948|Ga0126375_11255301All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300015241|Ga0137418_10491866Not Available983Open in IMG/M
3300015242|Ga0137412_10089391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2505Open in IMG/M
3300016319|Ga0182033_10752670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium HGW-Firmicutes-11856Open in IMG/M
3300016371|Ga0182034_10260311All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300016387|Ga0182040_10350680All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300018482|Ga0066669_10513242All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300020140|Ga0179590_1080459Not Available866Open in IMG/M
3300020579|Ga0210407_10312562All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1227Open in IMG/M
3300020579|Ga0210407_10597994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium860Open in IMG/M
3300020580|Ga0210403_10093487All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2434Open in IMG/M
3300020580|Ga0210403_10243743Not Available1474Open in IMG/M
3300020580|Ga0210403_10472416Not Available1020Open in IMG/M
3300020580|Ga0210403_11250799All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300020581|Ga0210399_10005522All Organisms → cellular organisms → Bacteria → Acidobacteria9826Open in IMG/M
3300020581|Ga0210399_10076720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2710Open in IMG/M
3300020581|Ga0210399_10500120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1010Open in IMG/M
3300020582|Ga0210395_10565899All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300020583|Ga0210401_10902932All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300021170|Ga0210400_10985076Not Available686Open in IMG/M
3300021171|Ga0210405_10332058All Organisms → cellular organisms → Bacteria → Acidobacteria1200Open in IMG/M
3300021403|Ga0210397_10765791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300021432|Ga0210384_10035800All Organisms → cellular organisms → Bacteria4597Open in IMG/M
3300021432|Ga0210384_11037061Not Available722Open in IMG/M
3300021560|Ga0126371_11275958All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300022533|Ga0242662_10224705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300024178|Ga0247694_1034974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella pectinivorans565Open in IMG/M
3300024232|Ga0247664_1031983Not Available1226Open in IMG/M
3300024246|Ga0247680_1030741All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300024323|Ga0247666_1029390All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1150Open in IMG/M
3300025906|Ga0207699_10768521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter acidisoli707Open in IMG/M
3300025922|Ga0207646_11295144All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300025981|Ga0207640_11379343All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300026315|Ga0209686_1083453All Organisms → cellular organisms → Bacteria → Acidobacteria1127Open in IMG/M
3300026319|Ga0209647_1296822Not Available543Open in IMG/M
3300026723|Ga0208342_101544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300026909|Ga0207858_1008793Not Available1011Open in IMG/M
3300027010|Ga0207839_1034946Not Available570Open in IMG/M
3300027330|Ga0207777_1048616Not Available754Open in IMG/M
3300027610|Ga0209528_1121348Not Available576Open in IMG/M
3300027875|Ga0209283_10307811All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300027882|Ga0209590_10509681All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300027915|Ga0209069_10586433All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae640Open in IMG/M
3300027915|Ga0209069_10748866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus578Open in IMG/M
3300031231|Ga0170824_103053322All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1468Open in IMG/M
3300031474|Ga0170818_104491854Not Available655Open in IMG/M
3300031545|Ga0318541_10534161All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium656Open in IMG/M
3300031720|Ga0307469_10045616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus2707Open in IMG/M
3300031744|Ga0306918_10026133All Organisms → cellular organisms → Bacteria → Acidobacteria3621Open in IMG/M
3300031942|Ga0310916_10237814All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300031942|Ga0310916_10923652All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300031947|Ga0310909_10847704All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300031954|Ga0306926_10896233All Organisms → cellular organisms → Bacteria → Acidobacteria1062Open in IMG/M
3300031962|Ga0307479_10478238All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1229Open in IMG/M
3300032076|Ga0306924_10337614All Organisms → cellular organisms → Bacteria → Acidobacteria1728Open in IMG/M
3300032174|Ga0307470_11201962All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300034125|Ga0370484_0065791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium916Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024246Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026723Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized - NN357 (SPAdes)EnvironmentalOpen in IMG/M
3300026909Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes)EnvironmentalOpen in IMG/M
3300027010Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10091255113300000955SoilLTRHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVYRFGR*
JGI12635J15846_1064802613300001593Forest SoilAFAAAAGGGADVTLTRHVSFRAIQVDYLYTHFAGAGQNNLRIQSGLVWRFGR*
Ga0062595_10169248113300004479SoilTLTKHVSFRAIQVEYLYTHFGGASQNNLRIQSGLVWRFGR*
Ga0066680_1007781013300005174SoilVTLTRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR*
Ga0066388_10250485713300005332Tropical Forest SoilDITLTRHVSFRAIQVEYLYTHFGGASQNSVRLQSGIVWRFGR*
Ga0070711_10023993913300005439Corn, Switchgrass And Miscanthus RhizosphereITLTRHVSFRAIQVEYLYTHFGGANQNNLRIQSGLVWRFGR*
Ga0070708_10059005213300005445Corn, Switchgrass And Miscanthus RhizosphereLTRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR*
Ga0070706_10089020113300005467Corn, Switchgrass And Miscanthus RhizosphereTLTRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR*
Ga0068853_10028324813300005539Corn RhizosphereAGGGADVTLTKHVSFRAIQVEYLYTHFGGASQNNLRIQSGLVWRFGR*
Ga0068858_10234208123300005842Switchgrass RhizosphereTLSKHVSLRAAQFDYFYTHFGGEGQNNFRIQTGIVYRFGR*
Ga0075024_10049773023300006047WatershedsTNAFAMTFGGGADVTLTRHVSFRAIQVEYLYTHFGGASQNNMRIETGLVWRFGR*
Ga0075017_10151691423300006059WatershedsSVNSFAMTFGGGADVRLTPRLSFRAIQAEYLYTHFSGVKQNNLRIQSGLVYHFGK*
Ga0070715_1101507313300006163Corn, Switchgrass And Miscanthus RhizosphereGAGSGSSNAFATALGGGADVTLTRHVSLRALQVDYFYTHFGGASQNNFRLQSGIVWRIGR
Ga0066658_1058752323300006794SoilGGGADFQVTHHLAFRAIQLEYLYTHFSGAKQNNLRLQSGLVYRFGK*
Ga0066665_1123623823300006796SoilSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR*
Ga0075426_1043328713300006903Populus RhizosphereADITLSKHVSLRAAQFDYLYTHFGGEGQNNFRIQSGIVYRFGR*
Ga0079219_1090447023300006954Agricultural SoilGGADVTLTRHVSLRLIQVEYLYTHFSSASQNSLKLQSGIVWRFGR*
Ga0079219_1153018223300006954Agricultural SoilGGADFTLTHHLAFRAIQFEYLYTHFGGAKQNNLRIQSGLVYRFGK*
Ga0099791_1003730723300007255Vadose Zone SoilAMTFGGGADVQLTPRLSFRAIQFEYLYTHFGGAKQNNLRIQSGLVYHFGK*
Ga0099794_1053367213300007265Vadose Zone SoilRHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYRFGR*
Ga0099828_1027791833300009089Vadose Zone SoilLAFRAIQVEYLYTHFGGTRQNNMRLQSGLVYRFGR*
Ga0099827_1148904823300009090Vadose Zone SoilSVNSFAMTFGGGADVKLTPHLAFRAIQFEYLYTHFSGVKQNNLRIQSGLVYHFGK*
Ga0126373_1026887943300010048Tropical Forest SoilTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR*
Ga0134109_1048549213300010320Grasslands SoilDVTLSRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR*
Ga0126370_1004236313300010358Tropical Forest SoilTLSKHVSLRAAQFDYFYTHFGGEGQNNFRIQSGIVYRFGR*
Ga0126370_1039044733300010358Tropical Forest SoilSLRAIQVEYFYTHFSSASQNNLRLQSGVVWRFGR*
Ga0126376_1239533313300010359Tropical Forest SoilAWTAGGGVDATLTQHVTFRAIQFEYLYTHLDGASQNSFRLQSGIVYRFGR*
Ga0126378_1166781623300010361Tropical Forest SoilTFRAIQFEYMYTHFGGASQNSFRLQSGIVYRFGR*
Ga0126377_1171792523300010362Tropical Forest SoilGGGADITLTRHVSLRALQVEYLYTHFGGASQNNLRLQSGLVWRFGR*
Ga0134066_1020478813300010364Grasslands SoilTLTRHVSFRAIQVEYLYTHFSSANQNSLRLQSGIVWRFGR*
Ga0126381_10047851223300010376Tropical Forest SoilLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR*
Ga0126381_10112634213300010376Tropical Forest SoilHVSLRAAQFDYFYTHFGGEGQNNFRIQSGIVYRFGR*
Ga0126381_10373573613300010376Tropical Forest SoilDVTLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFDR*
Ga0137392_1156828223300011269Vadose Zone SoilSRHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYRFGR*
Ga0137392_1163797213300011269Vadose Zone SoilTNAFAMTFGGGADVQLTPHLSFRAIQFEYLYTHFSGAKQNNLRIQSGLVYHFGK*
Ga0137388_1116345913300012189Vadose Zone SoilFGGGADVKLTPHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYHFGK*
Ga0137362_1179789213300012205Vadose Zone SoilLGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR*
Ga0137361_1006274843300012362Vadose Zone SoilPSTSVNSFAMTFGGGADVKLTPHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYHFGK*
Ga0137361_1085680513300012362Vadose Zone SoilPSTSVNSFAMTFGGGADVKLTPHLAFRAIQFEYLYTHFSGVKQNNLRIQSGLVYHFGK*
Ga0137390_1102750523300012363Vadose Zone SoilDFQVSRHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYRFGR*
Ga0137419_1015837233300012925Vadose Zone SoilGSGSSNAFASAIGGGADVTLTRHLSLRAFQLDYLYTHFNSSSQNNFRLQSGLVYRFGR*
Ga0137404_1009452513300012929Vadose Zone SoilRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR*
Ga0137404_1201327523300012929Vadose Zone SoilLSRHVTLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR*
Ga0126375_1125530113300012948Tropical Forest SoilKHVSLRAAQFDYFYTHFGGEGQNHFRIQSGIVYRFGR*
Ga0137418_1049186633300015241Vadose Zone SoilIGGGADVTLTRHLSLRAFQLDYLYTHFNSSSQNNFRLQSGLVYRFGR*
Ga0137412_1008939113300015242Vadose Zone SoilSTNAFATAVGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR*
Ga0182033_1075267033300016319SoilVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR
Ga0182034_1026031143300016371SoilGGGADVTLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR
Ga0182040_1035068033300016387SoilTLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR
Ga0066669_1051324223300018482Grasslands SoilAGGGADVTLTRHLSLRAIQVDYLYTHFGGASQNNFRLQSGIVYRFGR
Ga0179590_108045913300020140Vadose Zone SoilALATAVGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR
Ga0210407_1031256223300020579SoilTAVGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR
Ga0210407_1059799423300020579SoilADVTLTRHVSFRAIQVDYLYTHFAGTGQNNLRIQSGLVWRFGR
Ga0210403_1009348753300020580SoilADVTLSRHVTLRALQVDYLYTHFSGASQNNFRLQSGIVWRIGR
Ga0210403_1024374313300020580SoilRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR
Ga0210403_1047241613300020580SoilDVTLTRHLSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR
Ga0210403_1125079923300020580SoilGFPSASVNSFAMTFGGGADIQLTPRLSFRAIQGEYLYTHFSGAKQNNLRIQSGLVYHFGK
Ga0210399_10005522123300020581SoilLSRHVTLRALQVDYLYTHFSGASQNNFRLQSGIVWRIGR
Ga0210399_1007672013300020581SoilSTNAFATALGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR
Ga0210399_1050012023300020581SoilTAVGGGADVTLSRHVTLRALQVDYLYTHFSGASQNNFRLQSGIVWRIGR
Ga0210395_1056589923300020582SoilGVDVTLTRHVSFRAIQVEYLYTHFGGASQNNVRIQSGLVWRFGR
Ga0210401_1090293223300020583SoilSANSFAMTFGGGADIQLTHHLAFRAIQAEYFYTRFGGVGQNNLRIQSGLVYRFSK
Ga0210400_1098507613300021170SoilVPSTSVNSFAMTFGGGADIKLTPHVSFRAIQFEYLYTHFSGVKQNNLRIQSGLVYHFGK
Ga0210405_1033205833300021171SoilNAFAAAVGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR
Ga0210397_1076579113300021403SoilVTLSRHVTLRALQVDYLYTHFSGASQNNFRLQSGIVWRIGR
Ga0210384_1003580063300021432SoilNAYAMTFGGGADFTVTPHLAFRAIQFEYLYTHFGGAKQNNLRIQSGLVYRFGK
Ga0210384_1103706123300021432SoilGSTNAFATALGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR
Ga0126371_1127595823300021560Tropical Forest SoilGGADVTLSKHVSLRAIQFDYLYTRFGGASQNNLRLQSGIVWRFGR
Ga0242662_1022470513300022533SoilTNAFATALGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR
Ga0247694_103497413300024178SoilMTFGGGADFQVSRHFAFRAIQVEYLYTHFSGAKQNNVRIQSGLVYRFGK
Ga0247664_103198333300024232SoilDITLSKHVSLRAAQFDYLYTHFGGEGQNSFRIQSGIVYRFSR
Ga0247680_103074113300024246SoilAAAVGGGADVTLTRHVSLRAVQVDYLYTHFGGASQNNFRVQSGIVWRIGR
Ga0247666_102939013300024323SoilGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR
Ga0207699_1076852123300025906Corn, Switchgrass And Miscanthus RhizosphereSTDVVTLTRHVSLRAIQVDYLYTHFGGAGQNNLRIQSGLVWRFGR
Ga0207646_1129514413300025922Corn, Switchgrass And Miscanthus RhizosphereRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR
Ga0207640_1137934313300025981Corn RhizosphereAGGGADVTLTKHVSFRAIQVEYLYTHFGGASQNNLRIQSGLVWRFGR
Ga0209686_108345313300026315SoilGSLASNAFAWTAGGGADVTLTRHVSLRAIQVEYLYTRFGGASQNSMRVQSGIVWRFGR
Ga0209647_129682213300026319Grasslands SoilTLTRHLSLRAFQLDYLYTHFNSASQNNFRLQSGLVYRFGR
Ga0208342_10154423300026723SoilWGADITLTRHVSFRAQADYLYTHFSSANQNSLRLQSGIVWRFGR
Ga0207858_100879323300026909Tropical Forest SoilGGGADVTLTQHVSLRAIQVEYLYTHFGGASQNSFRLQSGIVWRFGR
Ga0207839_103494623300027010Tropical Forest SoilLTQHVSLRAIQVEYLYTHFGGASQNSFRLQSGIVWRFGR
Ga0207777_104861613300027330Tropical Forest SoilTLTQHVSLRAIQVEYLYTHFGGASQNSFRLQSGIVWRFGR
Ga0209528_112134813300027610Forest SoilGGADFKVTRHLAFRAIQLEYLYTHFGGAKQNNLRLQSGLVYRFGK
Ga0209283_1030781113300027875Vadose Zone SoilLAFRAIQVEYLYTHFGGARQNNMRLQSGLVYRFGR
Ga0209590_1050968113300027882Vadose Zone SoilGADFQVTRHLAFRAIQVEYLYTHFGGARQNNMRLQSGLVYRFGR
Ga0209069_1058643323300027915WatershedsTNAFAMTFGGGADVTLTRHVSFRAIQVEYLYTHFGGASQNNMRIETGLVWRFGR
Ga0209069_1074886623300027915WatershedsATGFPSASVNSFAMTFGGGADVRLTPRLSFRAIQAEYLYTHFSGAKQNNLRIQSGLVYHFGK
Ga0170824_10305332213300031231Forest SoilSNAFATALGGGADVTLTRHVSLRAIQVDYLYTHFSGAGQNNLRIQSGLVWRFGR
Ga0170818_10449185413300031474Forest SoilAAAGGGADVTLTKHLSLRAIQVDYLYTHFSGASQNNFRLQSGIVYRFGR
Ga0318541_1053416123300031545SoilSKHVSLRAIQFDYLYTHFGGASQNNLRLQSGIVWRFGR
Ga0307469_1004561613300031720Hardwood Forest SoilASVNSFAMTFGGGADVRLTPRLSFRAIQAEYLYTHFSGVKQNNLRIQSGLVYHFGK
Ga0306918_1002613383300031744SoilISLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR
Ga0310916_1023781433300031942SoilADVTLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR
Ga0310916_1092365233300031942SoilHISLRAAQFDYFYTHFGGEGQNNFRIQSGIVYRFGR
Ga0310909_1084770423300031947SoilADVTLSKHVSLRAIQVEYLYTHFGGASQNNLRIQSGIVWRFGR
Ga0306926_1089623313300031954SoilHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR
Ga0307479_1047823823300031962Hardwood Forest SoilAFAMTFGGGADVELTRHLSFRAIQFEYLYTHFSGAKQNNLRIQSGLVYHFGK
Ga0306924_1033761413300032076SoilTKHVSLRAIQVEYLYTHFGNASQNNLRLQSGIVWRFGR
Ga0307470_1120196213300032174Hardwood Forest SoilDITLSKHVSLRAVQFDYFYTHFGGEGQNNFRIQSGIVYRFGR
Ga0370484_0065791_3_1613300034125Untreated Peat SoilAFAAAAGGGADVTLTRHVSLRAIQVDYLYTHFAGAGQNNLRIQSGLVWRFGR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.