Basic Information | |
---|---|
Family ID | F105825 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 41 residues |
Representative Sequence | VNFVSSGVVANQTGQLGFKKAFLVRDPDGHAIEIEEK |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.00 % |
% of genes near scaffold ends (potentially truncated) | 95.00 % |
% of genes from short scaffolds (< 2000 bps) | 94.00 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.69% Coil/Unstructured: 72.31% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF08240 | ADH_N | 2.00 |
PF03200 | Glyco_hydro_63 | 2.00 |
PF16912 | Glu_dehyd_C | 1.00 |
PF12439 | GDE_N | 1.00 |
PF00230 | MIP | 1.00 |
PF01979 | Amidohydro_1 | 1.00 |
PF12146 | Hydrolase_4 | 1.00 |
PF05742 | TANGO2 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 1.00 |
COG3332 | Uncharacterized stress-responsive protein, TANGO2 (Transport and Golgi organisation 2) family, contains NRDE motif | General function prediction only [R] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.00 % |
Unclassified | root | N/A | 5.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000703|JGI12416J11903_101977 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300001867|JGI12627J18819_10373665 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300002562|JGI25382J37095_10228828 | Not Available | 561 | Open in IMG/M |
3300005093|Ga0062594_103067927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 522 | Open in IMG/M |
3300005176|Ga0066679_10157890 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
3300005455|Ga0070663_100389591 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300005456|Ga0070678_101460707 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005526|Ga0073909_10000777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10119 | Open in IMG/M |
3300005546|Ga0070696_100626732 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300005548|Ga0070665_101640551 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300005555|Ga0066692_10749585 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005559|Ga0066700_10520007 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300005616|Ga0068852_100945861 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300006046|Ga0066652_101540224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Chlorogloeopsidaceae → Chlorogloeopsis → Chlorogloeopsis fritschii | 614 | Open in IMG/M |
3300006059|Ga0075017_100031007 | All Organisms → cellular organisms → Bacteria | 3524 | Open in IMG/M |
3300006172|Ga0075018_10154804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
3300006172|Ga0075018_10554616 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300006175|Ga0070712_101007216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300006354|Ga0075021_10441440 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300006358|Ga0068871_100646792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
3300006804|Ga0079221_10113449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
3300006854|Ga0075425_101777646 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300006854|Ga0075425_102512721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300009012|Ga0066710_101542344 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300009088|Ga0099830_10223601 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300010043|Ga0126380_11260658 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300010048|Ga0126373_12980765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300010303|Ga0134082_10368426 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300010335|Ga0134063_10431199 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300010339|Ga0074046_10290556 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300010361|Ga0126378_10529859 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300010361|Ga0126378_11255943 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300010376|Ga0126381_102223038 | Not Available | 789 | Open in IMG/M |
3300010376|Ga0126381_102990254 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300010376|Ga0126381_103112027 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300010379|Ga0136449_100890983 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300011270|Ga0137391_10196918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1753 | Open in IMG/M |
3300012200|Ga0137382_10750251 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300012201|Ga0137365_10479962 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300012202|Ga0137363_11467338 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300012206|Ga0137380_10780602 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300012211|Ga0137377_11015102 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300012224|Ga0134028_1156675 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300012349|Ga0137387_10387737 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300012349|Ga0137387_10446256 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300012362|Ga0137361_11047544 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300012362|Ga0137361_11730250 | Not Available | 544 | Open in IMG/M |
3300012389|Ga0134040_1156765 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
3300012403|Ga0134049_1138848 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300012930|Ga0137407_11547714 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300013102|Ga0157371_10407100 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300013102|Ga0157371_11116406 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300013296|Ga0157374_10244691 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
3300013308|Ga0157375_12903485 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300014162|Ga0181538_10127979 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300015053|Ga0137405_1128035 | Not Available | 1222 | Open in IMG/M |
3300015245|Ga0137409_10440714 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300016270|Ga0182036_10686749 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300016404|Ga0182037_10947647 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300016404|Ga0182037_11552540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300016445|Ga0182038_10473917 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300017932|Ga0187814_10406716 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300017946|Ga0187879_10270743 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300017994|Ga0187822_10301595 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300018043|Ga0187887_10138824 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
3300021168|Ga0210406_10677925 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300021178|Ga0210408_10725164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
3300021362|Ga0213882_10064161 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
3300021388|Ga0213875_10240264 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300025910|Ga0207684_10476338 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300025920|Ga0207649_11401228 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300026325|Ga0209152_10302270 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300026354|Ga0257180_1062076 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300026538|Ga0209056_10423721 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 792 | Open in IMG/M |
3300026542|Ga0209805_1020642 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 3453 | Open in IMG/M |
3300027527|Ga0209684_1053943 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300027824|Ga0209040_10107185 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300027824|Ga0209040_10141169 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300027875|Ga0209283_10330047 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300027911|Ga0209698_10427104 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300028380|Ga0268265_12646352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300028381|Ga0268264_10204034 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300031231|Ga0170824_110307263 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300031231|Ga0170824_111309008 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300031231|Ga0170824_117605106 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
3300031232|Ga0302323_101344358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300031781|Ga0318547_10517108 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300031910|Ga0306923_10796582 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300031912|Ga0306921_10102740 | Not Available | 3314 | Open in IMG/M |
3300032001|Ga0306922_11974488 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300032160|Ga0311301_10881292 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300032180|Ga0307471_100784859 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300032180|Ga0307471_102812543 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 618 | Open in IMG/M |
3300032180|Ga0307471_102936609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300032180|Ga0307471_103602046 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300032783|Ga0335079_10182105 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
3300032783|Ga0335079_10890390 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300033004|Ga0335084_11318538 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300033158|Ga0335077_10682343 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300033289|Ga0310914_11027476 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.00% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.00% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12416J11903_1019771 | 3300000703 | Tropical Forest Soil | RNARARFVSSGVVANHMKEIEFSKAFIVRDPDGHPVEIAAQ* |
JGI12627J18819_103736651 | 3300001867 | Forest Soil | AQVSFVSSGVVVNHTEQLGFTKAVVVRDPDGHAVEVEQK* |
JGI25382J37095_102288281 | 3300002562 | Grasslands Soil | EAKVSFVSSEVVANQNRELGFPKAFVVRDPDGHAIEIKEK* |
Ga0062594_1030679271 | 3300005093 | Soil | SAHTKFVSSGLVTESDGQLGFRNALLVRDPDGHPILIEEK* |
Ga0066679_101578904 | 3300005176 | Soil | ELGAGKTSFVSSGVVVNQKEQLGFHRAFVIRDPDGHAIELEEK* |
Ga0070663_1003895913 | 3300005455 | Corn Rhizosphere | SRVNFVSSGVVANQTGQLGFNKAFIVRDPDGHAVEFEEK* |
Ga0070678_1014607071 | 3300005456 | Miscanthus Rhizosphere | RQLQSSRVNFVSSGVVANQTGQLGFNKAFIVRDPDGHAVEFEEK* |
Ga0073909_1000077710 | 3300005526 | Surface Soil | VSSGVVANQTGQLGFKKALLVRDPDGHAIEIEEK* |
Ga0070696_1006267321 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | QTSRVNFVSSGVVANQTGQLGFNKAFIVRDPDGHAVEFEEK* |
Ga0070665_1016405513 | 3300005548 | Switchgrass Rhizosphere | KFVSSGLVTESDGQLGFRNALLVRDPDGHPILIEEK* |
Ga0066692_107495851 | 3300005555 | Soil | VNFVSSGVVANQTGQLGFSKALLVRDPDGHAIEIEEK* |
Ga0066700_105200071 | 3300005559 | Soil | QLHSGKVNFVSSGVVANQTGQLGFSKALLVRDPDGHAVEIEEK* |
Ga0068852_1009458611 | 3300005616 | Corn Rhizosphere | KLVSAHTKFVSSGLVTESDGQLGFRNALLVRDPDGHPVLIEEK* |
Ga0066652_1015402241 | 3300006046 | Soil | RVRFVSSGVVANHMQMLDFSKAFLVRDPDGHAIEIAAQ* |
Ga0075017_1000310071 | 3300006059 | Watersheds | VSSGVVANQTGQLGFSKALLVRDPDGHAIEIEEK* |
Ga0075018_101548043 | 3300006172 | Watersheds | VSSGVIANQNGQLGFSKAFVVRDPDGHAVEIEQK* |
Ga0075018_105546161 | 3300006172 | Watersheds | VNFVSSGVVANHTGQLGFSKALLVRDPDGHAIEIEEK* |
Ga0070712_1010072163 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FVSSGVVANQTGELGFSKAFVVRDPDGHAVELEEKNLEEK* |
Ga0075021_104414403 | 3300006354 | Watersheds | SSRVNFVSSGVVPNQTGQLGFSKAFVVRDPDGHAVEIEEK* |
Ga0068871_1006467923 | 3300006358 | Miscanthus Rhizosphere | SVAKANFVSSGLIVNHNGELGFSAAFIARDPDGHAVEIEQK* |
Ga0079221_101134493 | 3300006804 | Agricultural Soil | VSSGLVTESDGQLGFRNALLVRDPDGHPILIEEK* |
Ga0075425_1017776462 | 3300006854 | Populus Rhizosphere | MRRPVNCIAGNVIFVSSRVVANQNAQFEFTNAFLVRDAAGHAIEIEQK* |
Ga0075425_1025127211 | 3300006854 | Populus Rhizosphere | FVSSGVFIESDGQLGFKRAFLIRDPDGHAILIEEK* |
Ga0066710_1015423443 | 3300009012 | Grasslands Soil | TGRVNFVSSGVVANQTGQLGFSKALLVRDPDGHVIEIEEK |
Ga0099830_102236011 | 3300009088 | Vadose Zone Soil | FVSSGVVANQKTQLGFNKAFLVRDPDGHTIAIEER* |
Ga0126380_112606581 | 3300010043 | Tropical Forest Soil | DHAARDLSSKVNFVSFGVITNQMDKLGCKSAFIVRDPDGHAVEIEQK* |
Ga0126373_129807651 | 3300010048 | Tropical Forest Soil | DEAARDLFSAKVNFVSSGVIANQKDELDYKSAFIARDPDGHAMEIEQK* |
Ga0134082_103684263 | 3300010303 | Grasslands Soil | KVNFVSSGVVANQNEQLGFRKAFLARDPDGHAIEIEEK* |
Ga0134063_104311991 | 3300010335 | Grasslands Soil | KVNFVSSSVVANQNEQLGFRKAFLARDPDGHAIEIEEK* |
Ga0074046_102905563 | 3300010339 | Bog Forest Soil | AARQLQTSRVNFVSSGVFVNQTGELGFSKAFLVRDPDGHTVEIEEK* |
Ga0126378_105298593 | 3300010361 | Tropical Forest Soil | LYSAKVNFVSSAVIANQKDELGYRTAFIVRDPDGHAVEIEQK* |
Ga0126378_112559431 | 3300010361 | Tropical Forest Soil | AARNLFSAKVSFVSSGVIANQKRELGYGSAFIVRDPDGHAIEIEQK* |
Ga0126381_1022230383 | 3300010376 | Tropical Forest Soil | TARVNFVSSDVVVNQITQLGFSKAFVVRDPDGHALEIEET* |
Ga0126381_1029902541 | 3300010376 | Tropical Forest Soil | TVLVTESTDQAARDLFSAKVNFVSSAEIANQKDELGYRTAFIVRDPDGPAVEIEQK* |
Ga0126381_1031120273 | 3300010376 | Tropical Forest Soil | RDLLLAKVNFVSSGVVENQMDKLGYRTAFIVRDPDGHAVEIEQK* |
Ga0136449_1008909833 | 3300010379 | Peatlands Soil | SRVNFVSSGVFVNQTGELGFSKAFLVRDPDGHAVEIEEK* |
Ga0137391_101969183 | 3300011270 | Vadose Zone Soil | LYGGKVRFVSFGVVANQKGQLGFDKAFLARDPDGRVMAIAER* |
Ga0137382_107502511 | 3300012200 | Vadose Zone Soil | HAGNVIFVSSVMVANQNAQLGFAKAFLVRDADEHAIEIEQK* |
Ga0137365_104799621 | 3300012201 | Vadose Zone Soil | NFVSSGLIVNHSRELAFTSAFIVRDPDGHAVEVEQK* |
Ga0137363_114673381 | 3300012202 | Vadose Zone Soil | FVSSGVVANQTGQLGFNKAFLIRDPDGHVIELEEK* |
Ga0137380_107806021 | 3300012206 | Vadose Zone Soil | RRLQSSRVNFVSAGVVANQTGQLGFSKALLVRDPDGHAIEIEEK* |
Ga0137377_110151021 | 3300012211 | Vadose Zone Soil | VSPRVVALPDGPLGFREAFLARDPDGHALQFRSR* |
Ga0134028_11566753 | 3300012224 | Grasslands Soil | VSSGVVANQNEQLGFRKAFLARDPDGHAIEIEEK* |
Ga0137387_103877373 | 3300012349 | Vadose Zone Soil | FVSSGVVVNQTGQLGFNKAFVVRDPDGHPIEIEEK* |
Ga0137387_104462563 | 3300012349 | Vadose Zone Soil | QLQSGKVNFVSSGVVANQTGELGFSKALLVRDPDGHAIEIEEK* |
Ga0137361_110475441 | 3300012362 | Vadose Zone Soil | SFVSSGVLANPTGQLGFQKALLVRDPDGHTIEIEEK* |
Ga0137361_117302503 | 3300012362 | Vadose Zone Soil | NFVSSGVVANQTGQLGFNKAFIVRDPDGHAVELEEK* |
Ga0134040_11567651 | 3300012389 | Grasslands Soil | KVNFVSSGVVANQNEQLGFRKAFLARDPDGHAIEVEEK* |
Ga0134049_11388481 | 3300012403 | Grasslands Soil | FVSSGVVANPTGEPGFKKALLVRDPDGHVIELEQK* |
Ga0137407_115477141 | 3300012930 | Vadose Zone Soil | NCNAGNVIFVSSGVVANQNAQLGFAKAFLVRDADGHAIEIEQK* |
Ga0157371_104071001 | 3300013102 | Corn Rhizosphere | VGARVNFVSSGVVANQNNRLGFSKALVVRDPDGHAIEVEQK* |
Ga0157371_111164063 | 3300013102 | Corn Rhizosphere | ADQAARNLALAKLNFVSSEVVANHNAQLEFTSAFIVRDPDGHAVEIQQK* |
Ga0157374_102446911 | 3300013296 | Miscanthus Rhizosphere | SSRVNFVSSGVVANQTGQLGFNKAFIVRDPDGHAVEFEEK* |
Ga0157375_129034853 | 3300013308 | Miscanthus Rhizosphere | ARQLQSSRVNFVSSGVVANQTGQLGFNKAFIVRDPDGHAVEFEEK* |
Ga0181538_101279792 | 3300014162 | Bog | MTRSSAETERVTLVSSGVIANQAGQLGFSKALPVRDRDGHAIEMEEK* |
Ga0137405_11280351 | 3300015053 | Vadose Zone Soil | SSGVVANQKGQQLGFNKAFLARDPDGHVMAIAER* |
Ga0137409_104407141 | 3300015245 | Vadose Zone Soil | RDRVNFVSSGVIANQTGQLRFSKAFLVRDPDGHAIEIEEK* |
Ga0182036_106867494 | 3300016270 | Soil | AQKLSANGTNFVSSGVVPNPTGQIGFSKAFLVRDADGHPIEFEEK |
Ga0182037_109476473 | 3300016404 | Soil | LFSAKVNFVSSGVIANQMDELGYRAAFMVRDPDGHAVEIEQK |
Ga0182037_115525401 | 3300016404 | Soil | TTQNADGAAQKLSANGTNFVSSGVVPNPTGQIGFSKAFLVRDADGHPIEFEEK |
Ga0182038_104739173 | 3300016445 | Soil | LAKVNFVSSGVIANQKDELGFRTALIVRDPDGHAVEIEQK |
Ga0187814_104067161 | 3300017932 | Freshwater Sediment | ARSLSAAQVNFVSSGAVVNHMEQLGFTKAVIVRDPDGHAIEVEEK |
Ga0187879_102707433 | 3300017946 | Peatland | TFVSSGVVANQTGKLGFSKAFVVRDPDGHAIEIEEK |
Ga0187822_103015951 | 3300017994 | Freshwater Sediment | EQAAHDLTSAKVNLVSSRLVANQTEQLGFKSALIVRDPDGHAVEIEQK |
Ga0187887_101388241 | 3300018043 | Peatland | TSRVTFVSSGVVANQTGKLGFSRAFVVRDPDGHAIEIEEK |
Ga0210406_106779253 | 3300021168 | Soil | NQFVSSGMIANQNGQLEFSKALVIRYSDGHAIEIEQK |
Ga0210408_107251642 | 3300021178 | Soil | VAKHTSRVNFVSSGVVADQTTQMGFNKTFLVRDPDGHVVENEEK |
Ga0213882_100641611 | 3300021362 | Exposed Rock | LTTGADNAAHNLSSAQVNFVSSGVVVNQIHLLGFSRAFVIRDPDGHAIEIEEK |
Ga0213875_102402643 | 3300021388 | Plant Roots | VNFVSSGVVANQIHLLGFSRAFVIRDPDGHAIEIEEK |
Ga0207684_104763382 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | HASFVSSGVIAESDGQLGFKKAFVVRDPDGHAILVEEK |
Ga0207649_114012282 | 3300025920 | Corn Rhizosphere | FSNAHASFVSSGVVTESDGQLGFKKAFVARDPDGHAILVEEK |
Ga0209152_103022703 | 3300026325 | Soil | SNAHASFVSSGVVAESDGQLGFKKAFLARDPDGHAILVEER |
Ga0257180_10620761 | 3300026354 | Soil | SFVSSEVVANQNRGLEFTKAFVVRDPDGHAIEIEER |
Ga0209056_104237212 | 3300026538 | Soil | GRNLANAKINFVSSGVVVNQNNQLGFSKALVVRDPDGHAIEIEQK |
Ga0209805_10206421 | 3300026542 | Soil | NFVSSGVVANQNEQLGFRKAFLARDPDGHAIEIEEK |
Ga0209684_10539431 | 3300027527 | Tropical Forest Soil | SAKVNFVSSAVIANQKDELGYRTAFIVRDPDGHAVEIEQK |
Ga0209040_101071853 | 3300027824 | Bog Forest Soil | RVTFVSSGVVANHMRMLDFSKAFLVRDPDGHAIEIAAP |
Ga0209040_101411692 | 3300027824 | Bog Forest Soil | TSRVNFVSSGVFVNQTGELGFSKAFLVRDPDGHAVEIEEK |
Ga0209283_103300471 | 3300027875 | Vadose Zone Soil | YMARVNFVSSGVVVNQKRQLGFNKAFLVRDPDGHAILIAEK |
Ga0209698_104271041 | 3300027911 | Watersheds | KTQFVSSGVIANQNGQLGFSKAFTVRDPDGHAIEIEQK |
Ga0268265_126463522 | 3300028380 | Switchgrass Rhizosphere | VSSGVVANQTGELGFSKAFVVRDPDGHAVELEEKNLEEK |
Ga0268264_102040343 | 3300028381 | Switchgrass Rhizosphere | QSSRVNFVSSGVVANQTGQLGFNKAFIVRDPDGHAVEFEEK |
Ga0170824_1103072631 | 3300031231 | Forest Soil | VNFVSSGVVANQTGQLGFSKALLVRDPDGHAIEIEEK |
Ga0170824_1113090081 | 3300031231 | Forest Soil | ARQLNSGKVNFVSSGVVTNQTGQLGFSKALLVRDPDGHAVEIEEK |
Ga0170824_1176051063 | 3300031231 | Forest Soil | VNFVSSGVVANQTGQLGFKKAFLVRDPDGHAIEIEEK |
Ga0302323_1013443583 | 3300031232 | Fen | SAARQLSTAKAIFVSSGVVPNHNPQLGFTKALVVRDPDGHAVELEQK |
Ga0318547_105171083 | 3300031781 | Soil | ARDLFLAKVNFVSSGVIANQKDELGFRTALIVRDPDGHAVEIEQK |
Ga0306923_107965821 | 3300031910 | Soil | VNFVSSGVIANQKDELGYRAAFIVRDPDGHAVEIEQK |
Ga0306921_101027404 | 3300031912 | Soil | LLLAKVNFVSSGVIANQKDELGFRTALIVRDPDGHAVEIEQK |
Ga0306922_119744881 | 3300032001 | Soil | AAFVSSGVVANPTGQLGFKKALLVRDPDRHVIELEEK |
Ga0311301_108812923 | 3300032160 | Peatlands Soil | SRVNFVSSGVFVNQTGELGFSKAFLVRDPDGHAVEIEEK |
Ga0307471_1007848591 | 3300032180 | Hardwood Forest Soil | AAKVKFVSSGVVANHMESLDFSKAFLVRDPDGHAIEIAAQ |
Ga0307471_1028125431 | 3300032180 | Hardwood Forest Soil | VDRAVRDLSAAQVNFVSSGIVVNHTEQIGFTNAVMVRDPDGHAVEVEEK |
Ga0307471_1029366093 | 3300032180 | Hardwood Forest Soil | LRAGKTSFVSSGVVVNQKEQLGFHRAFVIRDPDGHAIELKEK |
Ga0307471_1036020461 | 3300032180 | Hardwood Forest Soil | AARVNFVSSGVVANQKTQLGFNKAFLVRDPDGHTIAIEER |
Ga0335079_101821051 | 3300032783 | Soil | LAKTNFVSSGLIANQNRELGFKAAFVVRDPDGHAIEIEEK |
Ga0335079_108903901 | 3300032783 | Soil | ELGLAKATFVSSGLIANQTRELGFKAAFVVRDPDGHALEIEEK |
Ga0335084_113185381 | 3300033004 | Soil | AKANFVSSGLIANQNKELGFKTAFVVRDPDGHAIEIEEK |
Ga0335077_106823431 | 3300033158 | Soil | NFVSSGVIANQMDELGYRNALIVRDPDGHAVEIEQQ |
Ga0310914_110274763 | 3300033289 | Soil | SRLVSSGVVVNHTQELEFTKGFLVRDPDGHAIEIAGR |
⦗Top⦘ |