| Basic Information | |
|---|---|
| Family ID | F105652 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GPLVPYYTERGILVAVDADQPPDSVTADIQARLSGLARAADR |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00561 | Abhydrolase_1 | 10.00 |
| PF00196 | GerE | 9.00 |
| PF02467 | Whib | 9.00 |
| PF13191 | AAA_16 | 6.00 |
| PF03729 | DUF308 | 6.00 |
| PF12697 | Abhydrolase_6 | 6.00 |
| PF01381 | HTH_3 | 5.00 |
| PF12680 | SnoaL_2 | 3.00 |
| PF07690 | MFS_1 | 2.00 |
| PF00440 | TetR_N | 2.00 |
| PF08546 | ApbA_C | 2.00 |
| PF00719 | Pyrophosphatase | 2.00 |
| PF00702 | Hydrolase | 1.00 |
| PF00198 | 2-oxoacid_dh | 1.00 |
| PF13193 | AMP-binding_C | 1.00 |
| PF09594 | GT87 | 1.00 |
| PF02738 | MoCoBD_1 | 1.00 |
| PF02518 | HATPase_c | 1.00 |
| PF12146 | Hydrolase_4 | 1.00 |
| PF13006 | Nterm_IS4 | 1.00 |
| PF10432 | bact-PGI_C | 1.00 |
| PF13302 | Acetyltransf_3 | 1.00 |
| PF09900 | DUF2127 | 1.00 |
| PF00135 | COesterase | 1.00 |
| PF00107 | ADH_zinc_N | 1.00 |
| PF12695 | Abhydrolase_5 | 1.00 |
| PF00583 | Acetyltransf_1 | 1.00 |
| PF12802 | MarR_2 | 1.00 |
| PF14833 | NAD_binding_11 | 1.00 |
| PF13857 | Ank_5 | 1.00 |
| PF00106 | adh_short | 1.00 |
| PF02604 | PhdYeFM_antitox | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 6.00 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 2.00 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 2.00 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 1.00 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.00 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 1.00 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.00 % |
| Unclassified | root | N/A | 19.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001634|JGI20245J16306_1002350 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100502503 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10261611 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300004082|Ga0062384_101004579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300004092|Ga0062389_101591219 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300004635|Ga0062388_101548196 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005186|Ga0066676_10883515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 601 | Open in IMG/M |
| 3300005435|Ga0070714_100560563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1094 | Open in IMG/M |
| 3300005437|Ga0070710_10447882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 874 | Open in IMG/M |
| 3300005439|Ga0070711_100834208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 783 | Open in IMG/M |
| 3300005537|Ga0070730_11015605 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005591|Ga0070761_10689686 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005602|Ga0070762_10748124 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005602|Ga0070762_10853600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300005712|Ga0070764_10387302 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005952|Ga0080026_10253751 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006028|Ga0070717_11469556 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006102|Ga0075015_100676079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 611 | Open in IMG/M |
| 3300006175|Ga0070712_100144702 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300006176|Ga0070765_101095549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
| 3300006755|Ga0079222_10097985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1532 | Open in IMG/M |
| 3300006755|Ga0079222_12052716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300006893|Ga0073928_10130277 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300009143|Ga0099792_11171611 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009174|Ga0105241_11893693 | Not Available | 584 | Open in IMG/M |
| 3300009683|Ga0116224_10402539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
| 3300010048|Ga0126373_12321046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300010048|Ga0126373_12889024 | Not Available | 536 | Open in IMG/M |
| 3300010343|Ga0074044_10553389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 751 | Open in IMG/M |
| 3300010376|Ga0126381_101367880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1023 | Open in IMG/M |
| 3300010396|Ga0134126_12024403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
| 3300010876|Ga0126361_10044849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1274 | Open in IMG/M |
| 3300010876|Ga0126361_10694496 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. GAS474 | 1080 | Open in IMG/M |
| 3300011411|Ga0153933_1140777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300012203|Ga0137399_11762878 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012210|Ga0137378_10735626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224 | 898 | Open in IMG/M |
| 3300012683|Ga0137398_10459491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224 | 872 | Open in IMG/M |
| 3300014654|Ga0181525_10074663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1893 | Open in IMG/M |
| 3300018037|Ga0187883_10437828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 671 | Open in IMG/M |
| 3300018058|Ga0187766_10228392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1183 | Open in IMG/M |
| 3300020021|Ga0193726_1342113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300020582|Ga0210395_10052709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2979 | Open in IMG/M |
| 3300020582|Ga0210395_10245420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
| 3300020582|Ga0210395_10358879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1096 | Open in IMG/M |
| 3300020582|Ga0210395_10939389 | Not Available | 642 | Open in IMG/M |
| 3300020583|Ga0210401_10184636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1941 | Open in IMG/M |
| 3300021401|Ga0210393_10267054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1388 | Open in IMG/M |
| 3300021403|Ga0210397_10761104 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300021405|Ga0210387_10626778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224 | 955 | Open in IMG/M |
| 3300021405|Ga0210387_10627385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 954 | Open in IMG/M |
| 3300021406|Ga0210386_10394126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1193 | Open in IMG/M |
| 3300021432|Ga0210384_10156379 | Not Available | 2046 | Open in IMG/M |
| 3300021474|Ga0210390_10456551 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300021474|Ga0210390_10577989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300021474|Ga0210390_11270849 | Not Available | 591 | Open in IMG/M |
| 3300021479|Ga0210410_10682023 | Not Available | 908 | Open in IMG/M |
| 3300021560|Ga0126371_12302063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 651 | Open in IMG/M |
| 3300022512|Ga0242676_1009172 | Not Available | 874 | Open in IMG/M |
| 3300022525|Ga0242656_1105925 | Not Available | 556 | Open in IMG/M |
| 3300022531|Ga0242660_1094708 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300025906|Ga0207699_10014225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4095 | Open in IMG/M |
| 3300025915|Ga0207693_10068464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2778 | Open in IMG/M |
| 3300025915|Ga0207693_10384606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1097 | Open in IMG/M |
| 3300025928|Ga0207700_10453842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
| 3300025928|Ga0207700_10629022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224 | 956 | Open in IMG/M |
| 3300027029|Ga0208731_1037487 | Not Available | 532 | Open in IMG/M |
| 3300027066|Ga0208236_1006626 | Not Available | 741 | Open in IMG/M |
| 3300027168|Ga0208239_1014959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300027567|Ga0209115_1089250 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300027652|Ga0209007_1079508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300027652|Ga0209007_1092522 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300027737|Ga0209038_10046111 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. GAS474 | 1303 | Open in IMG/M |
| 3300028781|Ga0302223_10212306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300028789|Ga0302232_10457280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300028801|Ga0302226_10178906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300028801|Ga0302226_10200484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 855 | Open in IMG/M |
| 3300030399|Ga0311353_11719861 | Not Available | 503 | Open in IMG/M |
| 3300030494|Ga0310037_10130583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
| 3300030520|Ga0311372_10892804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
| 3300030580|Ga0311355_10500653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1165 | Open in IMG/M |
| 3300030741|Ga0265459_12597678 | Not Available | 626 | Open in IMG/M |
| 3300030743|Ga0265461_12836676 | Not Available | 579 | Open in IMG/M |
| 3300031027|Ga0302308_10184230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1350 | Open in IMG/M |
| 3300031236|Ga0302324_101271052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
| 3300031708|Ga0310686_112594618 | Not Available | 546 | Open in IMG/M |
| 3300031718|Ga0307474_10948455 | Not Available | 681 | Open in IMG/M |
| 3300031754|Ga0307475_10254497 | Not Available | 1407 | Open in IMG/M |
| 3300031765|Ga0318554_10124014 | Not Available | 1459 | Open in IMG/M |
| 3300031778|Ga0318498_10037099 | Not Available | 2134 | Open in IMG/M |
| 3300031823|Ga0307478_10943101 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300031879|Ga0306919_11053337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 621 | Open in IMG/M |
| 3300031912|Ga0306921_11631919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas flavigena → Cellulomonas flavigena DSM 20109 | 700 | Open in IMG/M |
| 3300032160|Ga0311301_12614073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Crossiella → Crossiella cryophila | 559 | Open in IMG/M |
| 3300032515|Ga0348332_13406791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300032828|Ga0335080_11772344 | Not Available | 603 | Open in IMG/M |
| 3300032892|Ga0335081_10809218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1118 | Open in IMG/M |
| 3300032896|Ga0335075_10094006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3958 | Open in IMG/M |
| 3300032896|Ga0335075_10391583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1483 | Open in IMG/M |
| 3300032898|Ga0335072_10229730 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
| 3300032954|Ga0335083_10938450 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001634 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027066 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20245J16306_10023501 | 3300001634 | Forest Soil | ATTGPLXPYYKERGILVAVNADQPPDAVTADIQAGLSGLSLSRA* |
| JGIcombinedJ26739_1005025031 | 3300002245 | Forest Soil | TTGPLVPYYTERGILVAVNADQSPDAVTADIEAKLSKLSLPHS* |
| JGIcombinedJ51221_102616112 | 3300003505 | Forest Soil | TTGSLVPYYQQRGILMTVNADQPPDAVFADIRAGLSELPFLAN* |
| Ga0062384_1010045791 | 3300004082 | Bog Forest Soil | AETTGPLVPYYTERGILVAVDADQPPDSVTADIQARLSGLTRTAGR* |
| Ga0062389_1015912192 | 3300004092 | Bog Forest Soil | GPLVPYYTERGILVAVDADQSPDSVTADIEARLSGLTRAAGR* |
| Ga0062388_1015481961 | 3300004635 | Bog Forest Soil | LVPYYTERGILVAVDADQPPDSVTADIQARLSGVPSGGTS* |
| Ga0066676_108835153 | 3300005186 | Soil | GPLVPYYTERGILVAVDADQPPEAVTADIQARLSGLARAANR* |
| Ga0070714_1005605633 | 3300005435 | Agricultural Soil | LVPYYTERGILVAVDADQPPDTVTADIQARLSGLARAADR* |
| Ga0070710_104478823 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LVPYYTERGILVAVDADQPPEAVTADIQARLSGLARAADR* |
| Ga0070711_1008342082 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GPLVPYYTERGILVAVDADQPPDTVTADIQARLSGLTRAADR* |
| Ga0070730_110156052 | 3300005537 | Surface Soil | LVPYYEQRGILVSVNADQPPDDVTADIEARLVGLPGAPA* |
| Ga0070761_106896861 | 3300005591 | Soil | PYYTERGILVAVDADQPPDSVLADIQARLSGVALGGTS* |
| Ga0070762_107481241 | 3300005602 | Soil | GPLVPYYTDRGILVAVDADQPPDSVTADIQSRLSRLSLP* |
| Ga0070762_108536002 | 3300005602 | Soil | GPLVPYYTERGILVAVNADQPVDSVTAGIQARLSELSILPSRPGPS* |
| Ga0070764_103873023 | 3300005712 | Soil | GALVPYYEQRGILVSVNADQPPDAVTADIQARLSSLPGASS* |
| Ga0080026_102537511 | 3300005952 | Permafrost Soil | YYTERGILVAVDADQPPDSVTADIRTRLSKLSLSSDALP* |
| Ga0070717_114695561 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAVDADQPPDTVTADIQARLSGLVRASGRWPGSHSGR* |
| Ga0075015_1006760792 | 3300006102 | Watersheds | YYTERGILVAVDADQPPDSVTADIQARLSGLTRAVGR* |
| Ga0070712_1001447021 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PLVPYYTERGILVAVDADQPPDSVTADILARLAELLPFLAG* |
| Ga0070765_1010955492 | 3300006176 | Soil | GPLVPYYTERGILVAVDADQPPDTVTADIEARLSGLARAADR* |
| Ga0079222_100979854 | 3300006755 | Agricultural Soil | SLVPYYTERGILVAVDADQPPDTVTAGIQARLSGLVRASGRQPGSRSCR* |
| Ga0079222_120527162 | 3300006755 | Agricultural Soil | SLVPYYTERGILVAVDADQPPDTVTAGIQARLSGLVRASGR* |
| Ga0073928_101302773 | 3300006893 | Iron-Sulfur Acid Spring | VPYYTERGILVAVNADQPPDSVTADIQSRLSSPPFSAP* |
| Ga0099792_111716111 | 3300009143 | Vadose Zone Soil | RGILVAVDADQPPASVAAGIQARLSGLARAAGRQQP* |
| Ga0105241_118936932 | 3300009174 | Corn Rhizosphere | GPLVPYYTERGILVAVDADQPPEAVTADIQARLSGLARAADR* |
| Ga0116224_104025391 | 3300009683 | Peatlands Soil | TGPLVPYYTERGILVAAEADQPPETVTADIQARLAGLTRAAGR* |
| Ga0126373_123210462 | 3300010048 | Tropical Forest Soil | RYYTQRGILITVDADQPPDSVTADIEAGLSTLSP* |
| Ga0126373_128890242 | 3300010048 | Tropical Forest Soil | VPYYTERGILVAVNADQPPDSVTANIQAGLSGLSTGGDRS* |
| Ga0074044_105533892 | 3300010343 | Bog Forest Soil | ERGILVAVDADQPPDSVTADIQARLSGLSLPRSNQTRSA* |
| Ga0126381_1013678801 | 3300010376 | Tropical Forest Soil | EMTGPLIAYYRNRGILVAVDADQPPESVTAEIQTRLDELSLPHHTG* |
| Ga0134126_120244032 | 3300010396 | Terrestrial Soil | YYDDRGILVAVDADQAPDSVTADIKARLSGLAGTDGR* |
| Ga0126361_100448494 | 3300010876 | Boreal Forest Soil | VPYYEQRGILVPVNADQPPDAVTADIQARLSSLPGVLS* |
| Ga0126361_106944961 | 3300010876 | Boreal Forest Soil | ETTGPLVPYYTERGILVAVDADQPPDSVTAEIQARLSDCG* |
| Ga0153933_11407771 | 3300011411 | Attine Ant Fungus Gardens | PLVNYYTERGILVAVDADQPPDSVTADIQAQLASLAG* |
| Ga0137399_117628781 | 3300012203 | Vadose Zone Soil | TGPLVPYYTERGILVAVDADQPPDSVTAGIQARLSGLARAVGRQQP* |
| Ga0137378_107356263 | 3300012210 | Vadose Zone Soil | VPYYTERGILVAVDADQSPETVTADIQARLSGLARAADR* |
| Ga0137398_104594912 | 3300012683 | Vadose Zone Soil | VPYYTERGILVAVDADQPPDSVTADIQSRLSGLSFTRG* |
| Ga0181525_100746631 | 3300014654 | Bog | TGLLVPYYTERGILVAVNADQPPDSVTADIQARLSTLAHPSGGASYPT* |
| Ga0187883_104378282 | 3300018037 | Peatland | YEERGILITVAADQPPDAVTAEIRTRLSGLNVSRY |
| Ga0187766_102283921 | 3300018058 | Tropical Peatland | YAERGILVAVDADQPPDSVTTDIQAQLSRLPRLPRDAAG |
| Ga0193726_13421131 | 3300020021 | Soil | TGPLVPYYTERGILVPVDADQPPGSVAAGIQAGLSALSQPR |
| Ga0210395_100527091 | 3300020582 | Soil | VPYYTERGILVAVDADQPPDSVTVDIQARLSGLTRTGTFS |
| Ga0210395_102454203 | 3300020582 | Soil | TGPLVPYYTERGILVAVDADRPPDSVTTEIQSRLSGLSLPGGTHL |
| Ga0210395_103588793 | 3300020582 | Soil | VPYYEQRGILVSVNADQPPDDVTADIQARLAGLPGAPV |
| Ga0210395_109393892 | 3300020582 | Soil | TGPLVPYYTERGILVAVDADQPPDSVTADIQSRLSGLSLPAT |
| Ga0210401_101846361 | 3300020583 | Soil | ERGILVAVDADQPPDSVTADIQSRLSGLSLPGGAHS |
| Ga0210393_102670541 | 3300021401 | Soil | TERGILVAVDADQPPDSVTADIQARLSGLARTAGR |
| Ga0210397_107611041 | 3300021403 | Soil | LVPYYTERGILVAVDADQPPDSVTADIQSRLSGLSLPGGSRS |
| Ga0210387_106267783 | 3300021405 | Soil | PLVPYYTERGILVAVDADQPADSVTADIQARLSGLARAADR |
| Ga0210387_106273851 | 3300021405 | Soil | YYTERGILVAVDADQPPDSVTADIQSRLSGLSLPGGAHL |
| Ga0210386_103941263 | 3300021406 | Soil | AEITGPLVPYYADRGILIAVNADQAPDSVTADIQARLSPPGK |
| Ga0210384_101563791 | 3300021432 | Soil | YYTERGILVAVDADQPADSVTADIQARLAGLARAAGR |
| Ga0210390_104565511 | 3300021474 | Soil | VPYYTERGILVAVNADQSPDAVTADIEAKLSKLSPPNA |
| Ga0210390_105779891 | 3300021474 | Soil | GPLVPYYTERGILVAVNADQSPDAVTADIEAKLSKLSLPSS |
| Ga0210390_112708493 | 3300021474 | Soil | TTGPLVSYYTERGILVAVDADQPPDSVTVDIQARLSGLTRAVGR |
| Ga0210410_106820234 | 3300021479 | Soil | GPLVPYYTERGILVAVDADQPPDSVTADIQARLSGLARAADR |
| Ga0126371_123020631 | 3300021560 | Tropical Forest Soil | EMTGPLVRYYTQRGILITVDADQPPDSVTADIEAGLSKLSP |
| Ga0242676_10091722 | 3300022512 | Soil | ETTGLLVPYYTERGILVAVDANQPPDSVTDDIQSRLSGLSLPGGSRS |
| Ga0242656_11059251 | 3300022525 | Soil | LVPYYTERGILVAVDADQPPEAVTADIQARLSGLAHAADR |
| Ga0242660_10947082 | 3300022531 | Soil | YYTERGILVAVDADRPPDSVTTEIQSRLSGLSLPGGTHL |
| Ga0207699_100142254 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | FAEMTGPLVRYYTQRGILITVDADQPPESVTADIQAGLSRLVR |
| Ga0207693_100684641 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GPLVPYYTERGILVAVDADQPPDSVTADILARLAELLPFLAG |
| Ga0207693_103846063 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VPYYTERGILVAVDADQPPDTVTADIQARLSGLTRAADR |
| Ga0207700_104538423 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TGPLVPYYDDRGILVAVDADQAPDSVTADIKARLSGLAGTAGR |
| Ga0207700_106290223 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LVPYYTERGILVAVDADQPPDTVTADIQARLSGLTRAADR |
| Ga0208731_10374872 | 3300027029 | Forest Soil | AETTGPLVPYYTERGILVAVNADQSPDAVTADIEAKLSKLSPPNA |
| Ga0208236_10066262 | 3300027066 | Forest Soil | LVPYYTERGILVAVNADQSPDAVTADIEAKLSKLPLPSS |
| Ga0208239_10149593 | 3300027168 | Forest Soil | VPYYTERGILVAVNADQSPDAVTADIEAKLSKLSLPNA |
| Ga0209115_10892503 | 3300027567 | Forest Soil | TGPLVPYYTERGILVAVNADQSPDAVTADIEAKLSKLSLPSS |
| Ga0209007_10795081 | 3300027652 | Forest Soil | TTGPLVPYYTERGILVAVNADQSPDAVTADIEAQLSKLPLPHS |
| Ga0209007_10925224 | 3300027652 | Forest Soil | TTGPLVPYYTERGILVAVNADQSPDAVTADIEAKLSKLSPPNA |
| Ga0209038_100461111 | 3300027737 | Bog Forest Soil | GPLVPYYTERGILVAVDADQPPDSVTADIQSRLSGLSLPGGSRS |
| Ga0302223_102123062 | 3300028781 | Palsa | YYTERGILVAVDADQPPDSVTADIQTRLSSVPMGGTA |
| Ga0302232_104572802 | 3300028789 | Palsa | LVPYYTERGILVTVDADQAPDSVTADIQTRLSSVPMGGTA |
| Ga0302226_101789062 | 3300028801 | Palsa | PYYEERGIFIAVAADQPPDAVTAEIRTRLSGLNLSRS |
| Ga0302226_102004843 | 3300028801 | Palsa | PYYTERGILVAVDADQPPDSVTADIQARLSKLSLPRS |
| Ga0311353_117198611 | 3300030399 | Palsa | TGPLVPYYTERGILVAVDADQPPDSVTADIQTRLSKLGLSPDALP |
| Ga0310037_101305831 | 3300030494 | Peatlands Soil | TGPLVPYYTERGILVAVDADQPPDSVTAGIQTGLSGLALPRS |
| Ga0311372_108928041 | 3300030520 | Palsa | ETTGPLVPYYTERGILVAVDADQPPDSVTADIQTRLSKLGLSPDALP |
| Ga0311355_105006532 | 3300030580 | Palsa | GLLVPYYTERGILVQVDADQSPDAVTADIQARLSKLGLSPDAHP |
| Ga0265459_125976781 | 3300030741 | Soil | PYYTERGILLTVNADQPPDAVTADIQAGLAGLGVPGAGKATA |
| Ga0265461_128366761 | 3300030743 | Soil | TTGPLVPYYKERGILIAVDADQPPDSVTADIQARLSGLTPAVGR |
| Ga0302308_101842304 | 3300031027 | Palsa | VPYYSERGILVTVNADQPPDSVTAGIQAGLSGLPLPGQRG |
| Ga0302324_1012710521 | 3300031236 | Palsa | YYSERGILVTVNADQPPDSVTAGIQAGLSGLPLPGQRG |
| Ga0310686_1125946181 | 3300031708 | Soil | ETTGPLVPYYTERGILVAVDADQPPDSVTEDIQARLSGLTRTGTFS |
| Ga0307474_109484551 | 3300031718 | Hardwood Forest Soil | TGPLVPYYTERGILVAVDADQPPDSVTAEIQSRLSGLALPAS |
| Ga0307475_102544971 | 3300031754 | Hardwood Forest Soil | VPYYTERGILVAVDADQPPDSVTADIQSRLSGLSLPGGPRS |
| Ga0318554_101240141 | 3300031765 | Soil | AETTGPLVPYYTERGILVAVDADQPPDSVTADITARLDFGD |
| Ga0318498_100370994 | 3300031778 | Soil | VFAETTGPLVPYYTERGILVAVDADQPPDSVTAGIQAALS |
| Ga0307478_109431012 | 3300031823 | Hardwood Forest Soil | PLVPYYTERGILVAVNADQPPDAVTADIQAGLSELSQPHS |
| Ga0306919_110533371 | 3300031879 | Soil | TGPLVPYYTERGILVAVDADQPPDAVTADIQSRLSELTTGGNRS |
| Ga0306921_116319193 | 3300031912 | Soil | TYYTERGILVAVDADQPPESVTADIQAGLSGLSPAGQPRT |
| Ga0311301_126140731 | 3300032160 | Peatlands Soil | AEATGPLVPYYTERGILVAVDADQPPDSVTAGIQTGLSGLALPRS |
| Ga0348332_134067911 | 3300032515 | Plant Litter | GPLVPYYTERGILVAVDADQPPDSVTADIQARLTVRGETRR |
| Ga0335080_117723441 | 3300032828 | Soil | LVPYYTERGILVAVDADQPPDSVTAAIQARVSGLTRAAGR |
| Ga0335081_108092182 | 3300032892 | Soil | YYTERGILVAVDADQPPDSVTAAIQARVSGLTRAAGR |
| Ga0335075_100940061 | 3300032896 | Soil | TTGPLVPYYTERGILVAVNADQPPDAVTADIQAKLSELSLPQS |
| Ga0335075_103915831 | 3300032896 | Soil | PYYEQRGLLVSVNADQPPDAVTADIQARLSGLAGAPA |
| Ga0335072_102297301 | 3300032898 | Soil | LYAQTTGPLVPYYTERGILVAVNADQPPDAVTADIQAKLSELSLPQS |
| Ga0335083_109384501 | 3300032954 | Soil | YYTERGILVAVDADQPPDTVTAGIQARLSGLVRASGRQPGSRSCR |
| ⦗Top⦘ |