NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105496

Metagenome / Metatranscriptome Family F105496

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105496
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 46 residues
Representative Sequence STNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND
Number of Associated Samples 87
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.00 %
% of genes from short scaffolds (< 2000 bps) 94.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(23.000 % of family members)
Environment Ontology (ENVO) Unclassified
(79.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(80.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.64%    β-sheet: 14.89%    Coil/Unstructured: 74.47%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00215OMPdecase 83.00
PF00216Bac_DNA_binding 11.00
PF00575S1 3.00
PF00697PRAI 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 11.00
COG0135Phosphoribosylanthranilate isomeraseAmino acid transport and metabolism [E] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.00 %
UnclassifiedrootN/A2.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876001|none_p135156Not Available575Open in IMG/M
3300000115|DelMOSum2011_c10196745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300000115|DelMOSum2011_c10215028Not Available528Open in IMG/M
3300000153|SI39nov09_135mDRAFT_c1003454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique4952Open in IMG/M
3300000199|SI39nov09_10mDRAFT_c1020310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300000239|SI36aug09_120mDRAFT_1068918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria621Open in IMG/M
3300000250|LPfeb09P261000mDRAFT_1032720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria769Open in IMG/M
3300000254|SI34jun09_100mDRAFT_1029551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1088Open in IMG/M
3300001349|JGI20160J14292_10083509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1216Open in IMG/M
3300001355|JGI20158J14315_10013451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique4468Open in IMG/M
3300002040|GOScombined01_100904338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria877Open in IMG/M
3300003501|JGI26243J51142_1069176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria639Open in IMG/M
3300003589|JGI26248J51725_1035927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter926Open in IMG/M
3300003589|JGI26248J51725_1051024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300003602|JGI26262J51727_1107352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300005239|Ga0073579_1161687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1013Open in IMG/M
3300005931|Ga0075119_1041966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1191Open in IMG/M
3300006191|Ga0075447_10278287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria539Open in IMG/M
3300006193|Ga0075445_10229654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria640Open in IMG/M
3300006947|Ga0075444_10301551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria618Open in IMG/M
3300007620|Ga0102871_1109198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria792Open in IMG/M
3300007715|Ga0102827_1003078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique3964Open in IMG/M
3300007778|Ga0102954_1003476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique4586Open in IMG/M
3300007863|Ga0105744_1062130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria921Open in IMG/M
3300007962|Ga0102907_1130553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria650Open in IMG/M
3300008253|Ga0105349_10252097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria735Open in IMG/M
3300009050|Ga0102909_1130337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria607Open in IMG/M
3300009057|Ga0102892_1032868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter971Open in IMG/M
3300009079|Ga0102814_10239728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter987Open in IMG/M
3300009080|Ga0102815_10629753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300009172|Ga0114995_10429785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M
3300009172|Ga0114995_10484126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300009173|Ga0114996_10648922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria779Open in IMG/M
3300009420|Ga0114994_11059991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300009422|Ga0114998_10440806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300009425|Ga0114997_10496714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria650Open in IMG/M
3300009436|Ga0115008_10483239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria884Open in IMG/M
3300009438|Ga0115559_1108643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1072Open in IMG/M
3300009442|Ga0115563_1238737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria681Open in IMG/M
3300009472|Ga0115554_1323875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria608Open in IMG/M
3300009476|Ga0115555_1344888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria596Open in IMG/M
3300009512|Ga0115003_10711320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria585Open in IMG/M
3300009512|Ga0115003_10713928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria583Open in IMG/M
3300009512|Ga0115003_10785565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300009526|Ga0115004_10564687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300009705|Ga0115000_10832079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300009785|Ga0115001_10409394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria846Open in IMG/M
3300009785|Ga0115001_10892396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria534Open in IMG/M
3300009786|Ga0114999_11032516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300012408|Ga0138265_1197607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria610Open in IMG/M
3300017725|Ga0181398_1149774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300020304|Ga0211684_1048266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria586Open in IMG/M
3300020309|Ga0211681_1046152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria732Open in IMG/M
3300020382|Ga0211686_10466398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300020396|Ga0211687_10301973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria631Open in IMG/M
3300021185|Ga0206682_10354336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria629Open in IMG/M
3300022851|Ga0222691_1032551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
(restricted) 3300022920|Ga0233426_10235786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
(restricted) 3300022933|Ga0233427_10074327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1702Open in IMG/M
(restricted) 3300024261|Ga0233439_10410379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300024346|Ga0244775_11272034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300024348|Ga0244776_10311804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1071Open in IMG/M
3300025547|Ga0209556_1102135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria623Open in IMG/M
3300025592|Ga0209658_1085029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria760Open in IMG/M
3300025623|Ga0209041_1173978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300025665|Ga0209360_1157897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria620Open in IMG/M
3300025700|Ga0209661_1135157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria736Open in IMG/M
3300025719|Ga0209252_1141258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria783Open in IMG/M
3300025869|Ga0209308_10365078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria585Open in IMG/M
3300025886|Ga0209632_10371860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria688Open in IMG/M
3300026183|Ga0209932_1027047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1473Open in IMG/M
3300027232|Ga0208803_1010355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2031Open in IMG/M
3300027253|Ga0208680_1073863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300027668|Ga0209482_1129571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria767Open in IMG/M
3300027704|Ga0209816_1025224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique3055Open in IMG/M
3300027704|Ga0209816_1075093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1403Open in IMG/M
3300027704|Ga0209816_1157423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria802Open in IMG/M
3300027752|Ga0209192_10319562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300027780|Ga0209502_10243182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria804Open in IMG/M
3300027780|Ga0209502_10289441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria710Open in IMG/M
3300027791|Ga0209830_10420285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300027801|Ga0209091_10250184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique861Open in IMG/M
3300027813|Ga0209090_10234050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria935Open in IMG/M
3300027827|Ga0209035_10563604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria546Open in IMG/M
3300027847|Ga0209402_10649037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300028194|Ga0257106_1083065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1169Open in IMG/M
3300028197|Ga0257110_1254722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300031510|Ga0308010_1235261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M
3300031519|Ga0307488_10180745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1447Open in IMG/M
3300031589|Ga0307996_1122417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria689Open in IMG/M
3300031599|Ga0308007_10170059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria770Open in IMG/M
3300031630|Ga0308004_10132024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1053Open in IMG/M
3300031630|Ga0308004_10227457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria747Open in IMG/M
3300031630|Ga0308004_10408019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300031655|Ga0308018_10160494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria770Open in IMG/M
3300031659|Ga0307986_10168580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1003Open in IMG/M
3300031659|Ga0307986_10261865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria741Open in IMG/M
3300031659|Ga0307986_10398102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria550Open in IMG/M
3300031695|Ga0308016_10177873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria827Open in IMG/M
3300031702|Ga0307998_1227021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria619Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine23.00%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine15.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine10.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.00%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine1.00%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.00%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.00%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine1.00%
Methane Seep MesocosmEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm1.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.00%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.00%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.00%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.00%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.00%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876001Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p1-CR7-chlmaxEnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000153Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 135mEnvironmentalOpen in IMG/M
3300000199Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 10mEnvironmentalOpen in IMG/M
3300000239Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 120mEnvironmentalOpen in IMG/M
3300000250Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P26 1000mEnvironmentalOpen in IMG/M
3300000254Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100mEnvironmentalOpen in IMG/M
3300001349Pelagic Microbial community sample from North Sea - COGITO 998_met_10EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300003501Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNAEnvironmentalOpen in IMG/M
3300003589Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_120m_DNAEnvironmentalOpen in IMG/M
3300003602Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_150m_DNAEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005931Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9EnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007620Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008253Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson CanyonEnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300020304Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556110-ERR599176)EnvironmentalOpen in IMG/M
3300020309Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX556064-ERR599104)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300022851Saline water microbial communities from Ace Lake, Antarctica - #1237EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025547Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025592Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025623Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025665Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025700Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025719Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026183Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027232Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027253Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027827Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031599Marine microbial communities from water near the shore, Antarctic Ocean - #71EnvironmentalOpen in IMG/M
3300031630Marine microbial communities from water near the shore, Antarctic Ocean - #38EnvironmentalOpen in IMG/M
3300031655Marine microbial communities from water near the shore, Antarctic Ocean - #282EnvironmentalOpen in IMG/M
3300031659Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82EnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031702Marine microbial communities from David Island wharf, Antarctic Ocean - #37EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
none_13515612236876001Marine EstuarineLYLGQLQINPIILGGLGWEVKNSKVLESEIPQILQGWIIDLSD
DelMOSum2011_1019674513300000115MarineINPIILGGVGWVVKNSKVLESEIPQILQGWIIDSSD*
DelMOSum2011_1021502813300000115MarineVLTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND*
SI39nov09_135mDRAFT_100345463300000153MarineVCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
SI39nov09_10mDRAFT_102031023300000199MarineNPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD*
SI36aug09_120mDRAFT_106891823300000239MarineNLFDLGQLQINLSSDGVGWEVKNSKVLESEIPQILQDRVIDLND*
LPfeb09P261000mDRAFT_103272023300000250MarineLSCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
SI34jun09_100mDRAFT_102955113300000254MarineCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD*
JGI20160J14292_1008350913300001349Pelagic MarineLCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
JGI20158J14315_1001345183300001355Pelagic MarineINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
GOScombined01_10090433813300002040MarineIGSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
JGI26243J51142_106917623300003501MarineLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD*
JGI26248J51725_103592733300003589MarineSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
JGI26248J51725_105102413300003589MarineNSFLSLLCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
JGI26262J51727_110735213300003602MarineLSTFNNSLSLLCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD*
Ga0073579_116168713300005239MarineNKSFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
Ga0075119_104196643300005931Saline LakeLLCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
Ga0075447_1027828723300006191MarineLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND*
Ga0075445_1022965423300006193MarineLFDLGQLQINPIILGGVGWEVKNSKVLESDIPQILQGWIIDLND*
Ga0075444_1030155113300006947MarineSLSYSTNLIDLGQLQINPIILGGVGWEVKNSKVLESETPQILQGWIIDLNDQLIF*
Ga0102871_110919823300007620EstuarineSTFNSTLSLSCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD*
Ga0102827_100307863300007715EstuarineSCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
Ga0102954_100347663300007778WaterSCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESETPQILQGWIIDLSD*
Ga0105744_106213013300007863Estuary WaterTLNSSLSLSYSTNLFDLGQLQINPIILGGVGWEVKNSKVFESEIPQILQGWIIDLND*
Ga0102907_113055323300007962EstuarineNNSLSLSCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLNDLLIF*
Ga0105349_1025209723300008253Methane Seep MesocosmSTFNSSLSLLCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD*
Ga0102909_113033723300009050EstuarineLSLLCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRVIDLSD*
Ga0102892_103286813300009057EstuarineSTFNSSLSLSCTTNHFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
Ga0102814_1023972813300009079EstuarineNLFDLGQLQINPIILGGVGWEVKNSKILESEIPQILQGWIIDLND*
Ga0102815_1062975313300009080EstuarineSLLCPTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD*
Ga0114995_1042978523300009172MarineTNLFDFGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLND*
Ga0114995_1048412623300009172MarineDLGQLQINPIILGGVGWAVKNSKVLESEIPQILQDRVIDLSD*
Ga0114996_1064892213300009173MarineQINPIILGGVGWAVKNSKILESEIPQILQDRVIDLND*
Ga0114994_1105999123300009420MarineLIDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLND*
Ga0114998_1044080623300009422MarineQLQINPIILGGVGCEVKNSKVLESEIPQILQGWIIDLND*
Ga0114997_1049671413300009425MarineGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND*
Ga0115008_1048323913300009436MarineTFNSFLSLSCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND*
Ga0115559_110864313300009438Pelagic MarineDFGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND*
Ga0115563_123873713300009442Pelagic MarineTFNSSLSLLFSTNLFDLGQLQINPIILGGVGCEVKNSKVLESEIPQILQGWIIDLND*
Ga0115554_132387513300009472Pelagic MarineLSLLCSTNLFDFGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND*
Ga0115555_134488813300009476Pelagic MarineLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD*
Ga0115003_1071132013300009512MarineGQLQINPIILGGAGWEVKNSKVLESEIPQILQGWIIDLNG*
Ga0115003_1071392823300009512MarineLRLSNSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND*
Ga0115003_1078556523300009512MarineDLGQLQINPIILGGVGWAVKNSKVLESEIPQILQDRVIDLND*
Ga0115004_1056468713300009526MarineNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLND*
Ga0115000_1083207923300009705MarineNSSLSLLCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND*
Ga0115001_1040939423300009785MarineLQINPIILGGVGWAVKNSKVLESEIPQILQDRVIDLSD*
Ga0115001_1089239623300009785MarineDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLNYQLIF*
Ga0114999_1103251623300009786MarineQLQINPIIFGGVGWVVKNSKVLESEIPQILQGWIIDLND*
Ga0138265_119760713300012408Polar MarineSYSTNLIDLGQLQINPIILGGVGWEVKNSKVLESQIPQILQGWIIDLNDQLIF*
Ga0181398_114977423300017725SeawaterRLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD
Ga0211684_104826623300020304MarineNLIDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND
Ga0211681_104615223300020309MarineDLGQLQINPIILGGLGWEVKNSKVLESEIPQILQGWIIDLND
Ga0211686_1046639823300020382MarineTNLFELGQLQINPIILGGVGWEVKNSKVFESEIPQILQGWIIDLND
Ga0211687_1030197313300020396MarineGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD
Ga0206682_1035433623300021185SeawaterCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLNDLLIF
Ga0222691_103255113300022851Saline WaterINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND
(restricted) Ga0233426_1023578623300022920SeawaterLQINPIILGGLGWAVKNFKVLESEIPQILQGWIIDSND
(restricted) Ga0233427_1007432713300022933SeawaterFNSFLSLLCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD
(restricted) Ga0233439_1041037913300024261SeawaterLSLLRSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD
Ga0244775_1127203423300024346EstuarineTFNSFLSLSCLTNLFDLGQLQINPIILGGVGWEVKNSKVLESETPQILQGWIIDLSD
Ga0244776_1031180433300024348EstuarineLSLSCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLNDLLIF
Ga0209556_110213513300025547MarineSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD
Ga0209658_108502923300025592MarineGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRVIDLSD
Ga0209041_117397813300025623MarineTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD
Ga0209360_115789723300025665MarineINPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD
Ga0209661_113515723300025700MarineSCSTNLFDLGQLQINPIIXGGVGWEVKNSKVLESEIPQILQDRVIDLSD
Ga0209252_114125823300025719MarineNPIILGGVGWEVKNSKVLESEIPQILQDRIIDLSD
Ga0209308_1036507813300025869Pelagic MarineNPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD
Ga0209632_1037186023300025886Pelagic MarineSLSCSTNLFDLGQLQINPINLGGVGWEVKNSKVLESEIPQILQGWIIDLND
Ga0209932_102704743300026183Pond WaterNSFLSLLCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD
Ga0208803_101035513300027232EstuarineSLSCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD
Ga0208680_107386323300027253EstuarineLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD
Ga0209482_112957113300027668MarineLQINPIILGGVGWEVKNSKVLESKIPQILQGCIIDLND
Ga0209816_102522453300027704MarineTNLFDLGQLQINPIILGGVGXEVKNSKVLESKIPQILQGWIIDLND
Ga0209816_107509313300027704MarineSTNLFDLGQLQINPIILGGVGWAVKNSKVLESEIPQILQDRVIDLND
Ga0209816_115742313300027704MarineSLSLSCSTNLFDLGQLQINPIILGGVEWEVKNSKVLESEIPQILQGWIIDLND
Ga0209192_1031956223300027752MarineGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND
Ga0209502_1024318213300027780MarineLSVSCSTNLIDLGQLQINPIILGGVGWEVKNSNVLESEIPQILQGWIIDLND
Ga0209502_1028944123300027780MarineINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLSD
Ga0209830_1042028523300027791MarineFDLGQLQINPIILGGVGWAVKNSKVLESEIPQILQDRVIDLND
Ga0209091_1025018413300027801MarineQIKPIIFGGVGCEVKNSKVLKSEIPQILQGWIIGLND
Ga0209090_1023405013300027813MarineSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND
Ga0209035_1056360423300027827MarineTNLFDLGQLHINPTILGGVGWEVKNSKVLESEIPQILQGWIIDLSD
Ga0209402_1064903723300027847MarineLPCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND
Ga0257106_108306513300028194MarineQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND
Ga0257110_125472223300028197MarineGQLQINPIILGGVGWAVKNSKVLESEIPQILQDRVIDLND
Ga0308010_123526113300031510MarineLQINPIILGGLGWEVKNSKVLKSEIPQILQGWIIDLND
Ga0307488_1018074513300031519Sackhole BrineSLSCSTNLFDLGQLQINPIILGGVGWEVKNSKVLESETPQILQGWIIDLSD
Ga0307996_112241713300031589MarineFDLGQLQINPIILGGVGWEVKNSKVLESETPQILQGWIIDLNDQLIF
Ga0308007_1017005913300031599MarineGQLQIKPIILGGVGCEVKNSKVLESEIPQILQDWIIDLND
Ga0308004_1013202413300031630MarineLGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND
Ga0308004_1022745723300031630MarineSTNLFDLGQLQINPIILGGVGWEVKNSKVLESETPQILQGWIIDLNDQLIF
Ga0308004_1040801923300031630MarineYSTNLFDLGQLQINPIILGGVGWEVKNSRVLESEIPQILQGWIIDLNDQLIF
Ga0308018_1016049413300031655MarineNPIIFGGVGWEVKNSKVLESDIPQILQGWIIDLND
Ga0307986_1016858013300031659MarineTFNSSLSLSYSTNLIDLGQLQINPIILGGVGWEVKNSKVLESETPQILQGWIIDLNDQLI
Ga0307986_1026186523300031659MarineINPIILGGVGWVVKNSKVLESEIPQILQGWIIDLND
Ga0307986_1039810213300031659MarineSTNLFDLGQLQINPIILGGVGWEVKNSRVLESEIPQILQGWIIDLNDQLIF
Ga0308016_1017787313300031695MarineCSTNLFDFGQLQINPIILGGVGWEVKNSKVLESEIPQILQGWIIDLND
Ga0307998_122702113300031702MarineTNLIDLGQLQINPIILGGVGWEVKNSKVLESETPQILQGWIIDLNDQLIF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.