NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105299

Metagenome / Metatranscriptome Family F105299

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105299
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 102 residues
Representative Sequence MNIELYTFAKTLKPSAMHKALEIKEQLEKKGQPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWEP
Number of Associated Samples 83
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 80.00 %
% of genes near scaffold ends (potentially truncated) 30.00 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(29.000 % of family members)
Environment Ontology (ENVO) Unclassified
(66.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.55%    β-sheet: 7.30%    Coil/Unstructured: 40.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004507|Ga0008280_1098534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300006357|Ga0075502_1337994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300006399|Ga0075495_1363586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300007760|Ga0105018_1121803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum894Open in IMG/M
3300008929|Ga0103732_1045762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300008993|Ga0104258_1102309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300008999|Ga0102816_1264959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300009024|Ga0102811_1291597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300009071|Ga0115566_10374664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300009263|Ga0103872_1002138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1303Open in IMG/M
3300009263|Ga0103872_1045916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300009265|Ga0103873_1067112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum710Open in IMG/M
3300009434|Ga0115562_1162164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300009434|Ga0115562_1165850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum813Open in IMG/M
3300009434|Ga0115562_1256269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300009441|Ga0115007_10403807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum894Open in IMG/M
3300009466|Ga0126448_1088200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300009470|Ga0126447_1099067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300009476|Ga0115555_1428505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300009497|Ga0115569_10238479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300009505|Ga0115564_10277232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum846Open in IMG/M
3300009543|Ga0115099_10467651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300009543|Ga0115099_10816462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300009592|Ga0115101_1164654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300009599|Ga0115103_1157893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300009599|Ga0115103_1345409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300009599|Ga0115103_1524587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300009606|Ga0115102_10224021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300009606|Ga0115102_10368701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300009608|Ga0115100_11248149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300009677|Ga0115104_10854502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300012504|Ga0129347_1256258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum710Open in IMG/M
3300012516|Ga0129325_1390342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300012520|Ga0129344_1168114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300012520|Ga0129344_1267410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300012954|Ga0163111_11024419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum798Open in IMG/M
3300012965|Ga0129346_1130833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300012969|Ga0129332_1102044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300016882|Ga0186577_107814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum691Open in IMG/M
3300017710|Ga0181403_1137482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300017951|Ga0181577_10556027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300018418|Ga0181567_10473147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300018420|Ga0181563_10506177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300018692|Ga0192944_1035767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum720Open in IMG/M
3300018730|Ga0192967_1045159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300018832|Ga0194240_1012907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300018842|Ga0193219_1078965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300018846|Ga0193253_1099059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300018874|Ga0192977_1075644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300018974|Ga0192873_10314564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300018980|Ga0192961_10136991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300018982|Ga0192947_10155614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300018982|Ga0192947_10236916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300018989|Ga0193030_10135195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum789Open in IMG/M
3300018989|Ga0193030_10135840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum787Open in IMG/M
3300018989|Ga0193030_10316645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300019010|Ga0193044_10207632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300019027|Ga0192909_10259890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300019036|Ga0192945_10159026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300019045|Ga0193336_10236622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300019050|Ga0192966_10356832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300019095|Ga0188866_1023321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300019095|Ga0188866_1023360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300019095|Ga0188866_1025781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300019095|Ga0188866_1027189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300019150|Ga0194244_10097951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300019200|Ga0180036_1029856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300021169|Ga0206687_1431521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300021365|Ga0206123_10219691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum837Open in IMG/M
3300021898|Ga0063097_1046958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300021902|Ga0063086_1009527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300021924|Ga0063085_1092632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300021942|Ga0063098_1088284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300024346|Ga0244775_11180480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300025626|Ga0209716_1106239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum790Open in IMG/M
3300025699|Ga0209715_1141675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300025894|Ga0209335_10422931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300026448|Ga0247594_1059911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300026495|Ga0247571_1141449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300026495|Ga0247571_1153104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300026503|Ga0247605_1123521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300027525|Ga0208437_1144465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300027757|Ga0208671_10288592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300027810|Ga0209302_10215094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum915Open in IMG/M
3300028137|Ga0256412_1241231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300028290|Ga0247572_1117374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300030709|Ga0307400_10775743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300030709|Ga0307400_10811584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300030709|Ga0307400_10834196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300031062|Ga0073989_11876435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300031621|Ga0302114_10205849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum824Open in IMG/M
3300031738|Ga0307384_10637804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300031750|Ga0307389_10890941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300032470|Ga0314670_10472337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300032491|Ga0314675_10422422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300032522|Ga0314677_10585425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300032617|Ga0314683_10838482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300032650|Ga0314673_10564250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300032666|Ga0314678_10487998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300033572|Ga0307390_10687579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine29.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine9.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.00%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.00%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.00%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water3.00%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond2.00%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.00%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.00%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.00%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.00%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007760Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016882Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)Host-AssociatedOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0008280_109853423300004507MarineMDIELYTFSKTLKPSAMHKAIAIKEKLENEGHPAKHFRVSLANMWGKGFKHEAVSNYAFVKEKLQDLDVAEKNLNRNIDSKAQLELFLGVASDVRN*
Ga0075502_133799423300006357AqueousLQELKNEENAKLLEDMNLELYTFAKTLKPSSFHKALAIKTKLEENGAPPKHFRVSTHNLWSKSFKHEAVPNYTFVKEKMADLDVAEKNLNRNIDSKPQLELFLKTAQDVKQAFLTRYGTDEWEP*
Ga0075495_136358613300006399AqueousMNIELYTFAKTLKPSAMHKALDIKEELEKKGHPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGEKEWEP*
Ga0105018_112180323300007760MarineMNIELYTFSKTLKPSALHKALDIKEKLESKNQPPAHFRVSTRNIWSKGFKHDQVANYVLVKEKMQDLDVAEKNLNRNIDSKA*
Ga0103732_104576223300008929Ice Edge, Mcmurdo Sound, AntarcticaMNIELYTFSKTLKPSSFHKALNIKEKLEEMNHSPSHFRVSLVNMWSKGFKHDAVANYAFVKEKLQDLDVAEKNLNRNIDSKAQLDIFLTTANDVKASFKKRYGEKEWEV*
Ga0104258_110230923300008993Ocean WaterMNIELYTFAKTLKPSAFHKALEIRTQLETDGSPPKHFRVSLANLWSKGFKHEAVGKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDL
Ga0102816_126495913300008999EstuarineMNIKEKLEEKNHAPKHFRVSLVNLWSKGFKHDAVANYQFVKESLQDLDVAEKNLNRNIDSKAQLEIFVKTAGDVKASFIKRYGAAEWEP*
Ga0102811_129159723300009024EstuarineMNIELFTFAKTLKPSNMRKALQIKEKLENDGFPPQHFRVSVVSLFQKGFKHEAVKNYKFVKESMEDLLVAEKNLNRNIDSSA*
Ga0115566_1037466413300009071Pelagic MarineMNIELYTFAKTLKPSAFHKALEIRTQLETDGSPPKHFRVSLANLWSKGFKHEAVGKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEWEP*
Ga0103872_100213823300009263Surface Ocean WaterMNIELYTFAKTLKPSAFHKALSIKEKLENDGHPPAHFRVSLANMWSKGFKHEAVANYGFVKEKLQDLDVAEKNLNRNIDSKAQLELFMGVANDVKQ*
Ga0103872_104591623300009263Surface Ocean WaterMDIELYTFAKTLKPSAMHKALSIKQKLEEDGHPPKHFRVSLANMWGKGFKHEAVSNYAFVKEKLLDLEVAEKNLNRNIDSKAQLELFLGVANDVRTQFKKRYGEKEWNP*
Ga0103873_106711213300009265Surface Ocean WaterMNIQLYTFAKTLKPSAMHQALAIKEKLESKGKGPEHFRVSARNLWSKGFHHEAVANYAFVREKLQDLDVAEKNLNRNIDSKAQLEIFI*
Ga0115562_116216413300009434Pelagic MarineMNIELYTFAKTLKPSAFHKAMEIKTQLENEASPPAHFRVSLSNLWSKGFKHDAVAKYTFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSGFKKRYGEKEWEP*
Ga0115562_116585013300009434Pelagic MarineMNIELYTFAKTLKPSAMHKALEIKEQLEKKNQPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWEP*
Ga0115562_125626913300009434Pelagic MarineMNIELYTFAKTLKPSAMHKALDIKEELEKKGHPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSK
Ga0115007_1040380723300009441MarineVKEDMNIELFTFSKTLKPSSLHKALDLKGKLEDKGHPPAHFRVAVRNLWSKGFKHDAVSNYAFVKDKFGELDIAEKNLNRNIDSKA*
Ga0126448_108820023300009466Meromictic PondMLIELFTFAKTLKPSSFHKALQIKDKLTENGFPPEHFRVSIHSLWSKGFKHDSVANYQFVKEKLQDLGVAEKNLNRNIDSKAQLDLFLTVANDVKNSFL*
Ga0126447_109906723300009470Meromictic PondMLIELFTFAKTLKPSSFHKALQIKDKLTENGFPPEHFRVSIHSLWSKGFKHDSVANYQFVKEKLQDLDVAEKNLNRNIDSKAQLDLFLTVANDVKNSFL*
Ga0115555_142850513300009476Pelagic MarineTFAKTLKPSAMHQALAIKEKLENAGRAPDHFRVAARNLWSKGFKHDAVANYQFVKESLQDLDVAEKNLNRNIDSKAQLEIFIKTAGDVKGAFIKRYGAAEWEP*
Ga0115569_1023847923300009497Pelagic MarineMNIELYTFAKTLKPSAMHKALEIKKELDDKGHSPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSHAQLDLFLQVANEVKSGFKKRYGEKEWEP*
Ga0115564_1027723213300009505Pelagic MarineMNIELYTFAKTLKPSAMHKALEIKEQLEKKNQPPAHCRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWEP*
Ga0115099_1046765123300009543MarineMNIELYTFAKTLKPSAMHKALEIKEQLEKKGHPPAHFRVSIVNLWSKGFKYDAVSRIDSIKEKLKDLKVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWEP*
Ga0115099_1081646213300009543MarineMNIKEKLEEKNHAPKHFRVSLVNLWSKGFKHDAVANYAFVKEKLQDLDVAEKNLNRNIDSKAQLDIFLTTANDVKASFKKRYGDKEWEP*
Ga0115101_116465423300009592MarineMNIELYTFAKTLKPSAMHKALEIKEQLEKKGQPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFIRRYGDYEWEL*
Ga0115103_115789323300009599MarineMTIELYTFAKTLKPSAIHKALSIKQKLEDSGYPPAHFRVAAHNLWSRGFKHENVANYKYVQDKLQDLDVAEKNLNRNIDSKPQLDMFLKTAQDVKDSFLKRFGAEEWQP*
Ga0115103_134540923300009599MarineMMIELFTFAKTLKPSSMHKALQLKEKLEGEGYAPEHFRVSIHSLWSKGFKHDSVANYQFVKDKLQDLDVAEKNLNRNIDSK
Ga0115103_152458713300009599MarineMNIELYTFAKTLKPSAFHKALSIKEKLETDGHPPAHFRVSLSNMWSKGFKHEAVANYGFVKEKLQDLDVAEKNLNRNIDSKAQLELFLGVASEAKAQFKKRYGDKEWNP*
Ga0115102_1022402113300009606MarineMNIELYTFAKTLKPSAFHKALSIKEKLETDGHPPAHFRVSLSNMWSKGFKHEAVANYGFVKEKLQDLDVAEKNLNRNIDSKAQLELFLGVASEAKAQFKKR
Ga0115102_1036870113300009606MarineMNIELYTFAKTLKPSAFHKALEIRTQLENEGNPPKHFRVSLSNLWSKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKGGFKKRYGEKEWEP*
Ga0115100_1124814913300009608MarineMNIELYTFAKTLKPSAMHKALEIKEQLEKKGQPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWE
Ga0115104_1085450223300009677MarineMKEDMNIELFTFSKTLKPSSLHKAIDLKEKLEAKGKPPAHFRVAVRNLWSKGFKHEAVSNYAFVKEKLQDIDVAEKNLNRNIDSHAQQEIFLTTANNVKKDFIKRYG
Ga0129347_125625823300012504AqueousMNIELYTFAKTLKPSAFHKALEIKTQLENEGNPPKHFRVSLANLWSKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEWEP*
Ga0129325_139034213300012516AqueousMNIELFTFAKTLKPSSMHKALQLKEKLENEGYPPEHFRVSIHSLWSKGFKHEAVANYQFVKDKLQDLDVAEKNLNRNIDSHA*
Ga0129344_116811423300012520AqueousMNIQLYTFAKTLKPSAMHQALAIKEKLESKGKGPEHFRVSARNLWSKGFHHEAVANYAFVREKLQDLDVAEKNLNRNIDSKAQLDIFI*
Ga0129344_126741023300012520AqueousMNIELYTFAKTLKPSAFHKALEIKTQLENEGNPPKHFRVSLANLWSKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEW
Ga0163111_1102441913300012954Surface SeawaterMNIELYTFAKTLKPSAMHKALEIKKELEDKGKPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVRSGFKKRYGEKEWEP*
Ga0129346_113083313300012965AqueousMNIELYTFAKTLKPSAFHKALEIKTQLENEGNPPKHFRVSLANLWSKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEWE
Ga0129332_110204413300012969AqueousMNIELYTFAKTLKPSAMHKALDIKEELEKKGHPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVAN
Ga0186577_10781413300016882Host-AssociatedVQQQLAQRRAQEEKDLEQSTEDLNYELFTFSKTLKPSAMHKALAIKEKMESQGHPPAHFRVSLVNLWSKGFKHEAVANYKFVKDKLQELDIAEKNLNRNIDSKAQLDIFLGTATDVKKQFKQRYGEAEWEP
Ga0181403_113748223300017710SeawaterLEDMNIELYTFAKTLKPSAFHKALEIKAQLENEGNPPKHFRVSLSNLWSKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSGFKKRYG
Ga0181577_1055602723300017951Salt MarshMNIELFTFAKTLKPSAMHKALQLKEKLENEGFPPEHFRVSIHSLWSKGFKHESVANYQFVKEKLQDLQVAETNLNRNIDSKAQLDLFL
Ga0181567_1047314723300018418Salt MarshMNIELYTFAKTLKPSAFHKALEIKTQLENEGNPPKHFRVSLANLWSKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEWEP
Ga0181563_1050617723300018420Salt MarshMNIELFTFAKTLKPSSMHKALQLKEKLENEGYPPEHFRVSIHSLWSKGFKHEAVANYQFVKDKLQDLDVAEKNLNRNIDSHA
Ga0192944_103576713300018692MarineMNIELYTFAKTLKPSAMHKALEIKEQLEKKDKPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWEP
Ga0192967_104515923300018730MarineMNIELYTFAKTLKPSAMHKALEIQKDLTEKGSPPAHFRVSLSNLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVRSGFKKRYGEKEWEP
Ga0194240_101290713300018832MarineMNIELYTFSKTLKPSSFHKALNLKEKLEESGHAPEHFRISLVNLWSKGFKHDAVANYAFVKEKLQDLDVAEKNLNRNIDSKAQLDIFLTTANDVKASFKKRYGEKEWEP
Ga0193219_107896523300018842MarineMNIELYTFAKTLKPSAFHKALEIKAQLENEGNPPKHFRVSLANLWSKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEWEP
Ga0193253_109905923300018846MarineMNIELYTFSKSLKPSSFHKAMNIKEKLEEKNHAPKHFRVSLVNLWSKGFKHDAVANYAFVKEKLQDLDVAEKNLNRNIDSKAQLDIFLTTANDVKASFKKRYGDKEWEP
Ga0192977_107564413300018874MarineMNIELYTFAKTLKPSAMHKALEIKEQLEKKDKPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWEP
Ga0192873_1031456423300018974MarineMNIELYTFSKTLKPSAMHQALAIKEKLDNAGTSPKHFRVATRQIWSKGFKHDSVANYQYVRDKLQDLDVAEKNLNRNIDSRAQLDIFIKTAGDVKKGFVKRYGEQEW
Ga0192961_1013699123300018980MarineMNIELYTFSKSLKPSSFHKALNIKEKLDESGHAPKHFRVSLVNMWSKGFKHDAVANYAFVKEKLQDLDVAEKNLNRNIDSKAQLDIFLTTANDVKSSFKKRYGEKEWEP
Ga0192947_1015561413300018982MarineMNIELYTFAKTLKPSAFHKALEIRTQLETDASPPKHFRVSLANLWSKGFKHEAVGKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEWEP
Ga0192947_1023691613300018982MarineMTIELYTFAKTLKPSSIHKALSIKQKLEDSGYPPAHFRVAAHNLWSRGFKHENVANYKYVQDKLQDLDVAEKNLNRNIDSKPQLDMFLKTAQDVKDSFLKRFGAEEWQP
Ga0193030_1013519513300018989MarineMNIELYTFAKTLKPSAIHKALSIKQKLEDSGHPPAHFRVAAHNLWSRGFKHENVANYKYVQDKLQDLDVAEKNLNRNIDSKPQLDMFLKTAQDVKDSFDKRFGAEEWQP
Ga0193030_1013584023300018989MarineMNIELYTFAKTLKPSAFHKALEIKAQLENEGNPPKHFRVSLANLWSKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSGFKKRYGEKEWEPXDT
Ga0193030_1031664523300018989MarineMNIELYTFAKTLKPSAFHKALEIRAQLENEGNPPKHFRVSLANLWSKGFKHDAVGKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSGFKKRYGE
Ga0193044_1020763213300019010MarineMNIELYTFAKTLKPSAMHKALEIKKDLEEKGHPPSHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVRSGFKKRYGEKEWEP
Ga0192909_1025989013300019027MarineMNIELYTFAKTLKPSAFHKALKIKAQLENEGNPPKHFRVSLANLWGKGFKHDAVSKYNFVKEKLEDLNVAEKNLNRNIDSHAQLDLFL
Ga0192945_1015902613300019036MarineMNIELYTFAKTLKPSAFHKALEIKTQLENEGNPPKHFRVSLSNLWSKGFKHDAVAKYNFVKEKLEDMNVAEKNLNRNIDSKAQLDLFLQVANDVKSGFKKRYGEKEWEP
Ga0193336_1023662213300019045MarineMNIELYTFAKTLKPSAFHKALEIRAQLENEGNPPKHFRVSLSNLWGKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEWEP
Ga0192966_1035683223300019050MarineMNIELYTFSKTLKPSSFHKALNIKEKLEEMNHSPSHFRVSLVNMWSKGFKHDAVANYAFVKEKLQDLDVAEKNLNRNIDSKAQLDIFLTTANDVKASFKKRYGEKEWEV
Ga0188866_102332113300019095Freshwater LakeMNIELYTFAKTLKPSAIHKALSIKQKLEDSGHPPAHFRVAAHNLWSRGFKHENVANYKYVQDKLQDLDVAEKNLNRNIDSKPQLDMFLKTAQDVKDSFEKRFGAEEWQP
Ga0188866_102336023300019095Freshwater LakeMNIELYTFAKTLKPSAMHKALEIKKDLEEKGKPPSHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVRSGFKKRYGEKEWEP
Ga0188866_102578123300019095Freshwater LakeMNIELYTFAKTLKPSAMHKALDIKEELEKKGHPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGEKEWEP
Ga0188866_102718913300019095Freshwater LakeMNIELYTFAKTLKPSAFHKALEIRTQLETDGSPPKHFRVSLANLWSKGFKHEAVGKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEWEP
Ga0194244_1009795113300019150MarineMNIELYTFAKTLKPSAMHKALEIKKELEDKGHPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVRSGFKKRYGEKEWEP
Ga0180036_102985613300019200EstuarineMDIELYTFSKTLKPSAMHKAIAIKEKLENEGHPAKHFRVSLANMWGKGFKHEAVSNYAFVKEKLQDLDVAEKNLNRNIDSKAQLELFLGVASDVRN
Ga0206687_143152113300021169SeawaterMHKALEIKEKLDNDGLSPEHFRVSLTSLWQKNFKHDSVANYPFVKEKLEDLSIAEKNLNRNIDSKAQLDIFLGTAKDVKDSFTKRFGDKEWSPNDKPRDPITNEEMLYLPKHRK
Ga0206123_1021969113300021365SeawaterMNIELYTFAKTLKPSAMHKALDIKEELEKKGHPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGEKEWEP
Ga0063097_104695823300021898MarineMNIELYTFSKSLKPSSFHKALNIKEKLDEAGHDPKHFRVSLVNMWSKGFKHDAVANYAFVKEKLQDLDVAEKNLNRNIDSKAQLDIFLTTANDVKSSFKKRYGEKEWEP
Ga0063086_100952723300021902MarineMNIELFTFSKTLKPSSLHKALDIKEKLEAKGKAPAHFRVAVRNLWSKGFKHEAVSNYAFVKEKMQDLDVAEKNLNRNIDSKAQ
Ga0063085_109263223300021924MarineMNIELYTFAKTLKPSAMHKALEIKKELDEKNKSPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVRSGFKKRYGEK
Ga0063098_108828423300021942MarineMNIELYTFSKSLKPSSFHKALNIKEKLDEAGHDPKHFRVSLVNMWSKGFKHDAVANYAFVKEKLQDLDVAEKNLNRNIDSKAQLDIFLTTANDVKS
Ga0244775_1118048023300024346EstuarineMDIELYTFSKTLKPSAMHKAIAIKEKLENEGHPAKHFRVSLANMWGKGFKHEAVSNYAFVKEKLQDLDVAEKNLNRNIDSKAQLELFLGVASDVR
Ga0209716_110623923300025626Pelagic MarineMNIELYTFAKTLKPSAFHKAMEIKTQLENEASPPAHFRVSLSNLWSKGFKHDAVAKYTFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSGFKKRYGEKEWEP
Ga0209715_114167523300025699Pelagic MarineMNIELYTFAKTLKPSAMHKALEIKKELDDKGHSPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSHAQLDLFL
Ga0209335_1042293113300025894Pelagic MarineYTFAKTLKPSAMHQALAIKEKLENAGRAPDHFRVAARNLWSKGFKHDAVANYQFVKESLQDLDVAEKNLNRNIDSKAQLEIFIKTAGDVKASFIKRYGAAEWEP
Ga0247594_105991113300026448SeawaterMNIELYTFAKTLKPSAMHKALEIKEQLEKKGQPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWEP
Ga0247571_114144923300026495SeawaterMNIELYTFAKTLKPSAFHKALEIRTQLETDGSPPKHFRVSLANLWSKGFKHEAVGKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKSSFKKRYGEKEW
Ga0247571_115310423300026495SeawaterMNIELYTFAKTLKPSAMHKALEIKEQLEKKGQPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVAN
Ga0247605_112352123300026503SeawaterMNIELYTFAKTLKPSAFHKALSIKEKLETDGHPPAHFRVSLSNMWSKGFKHEAVANYGFVKEKLQDLDVAEKNLNRNIDSKAQLELFLGVASEPKHNSKRGTEIRSGIHEETLLCFI
Ga0208437_114446513300027525EstuarineMNIELFTFAKTLKPSNMRKALQIKEKLENDGFPPQHFRVSVVSLFQKGFKHEAVKNYKFVKESMEDLLVAEKNLNRNIDSSA
Ga0208671_1028859223300027757EstuarineMDIELYTFSKTLKPSAMHKAIAIKEKLENEGHPAKHFRVSLANMWGKGFKHEAVSNYAFVKEKLQDLDVAEKNLNRNIDSKAQLELFLG
Ga0209302_1021509423300027810MarineMNIELFTFSKTLKPSSLHKALDLKGKLEDKGHPPAHFRVAVRNLWSKGFKHDAVSNYAFVKDKFGELDIAEKNLNRNIDSKA
Ga0256412_124123113300028137SeawaterMNIELYTFAKTLKPSAMHKALEIKKELEDKGKPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVRSGFKKRYGEKEWEP
Ga0247572_111737413300028290SeawaterMNIELYTFAKTLKPSAMHKALEIKEQLEKKGQPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFIRRYGDYEWEL
Ga0307400_1077574313300030709MarineMNIELYTFAKTLKPSAMHKALEIKEQLEKKDKPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKE
Ga0307400_1081158423300030709MarineMNIELYTFAKTLKPSAMHKALEIKKELDDKGKSPSHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKA
Ga0307400_1083419613300030709MarineMNIELYTFSKTLKPSSFHKALNIKEKLEEMNHSPSHFRVSLVNMWSKGFKHDAVANYAFVKEKLQDLDVAEKNLNRNIDSKAQLDIFLTTANDVKASFK
Ga0073989_1187643513300031062MarineMNIELYTFSKTLKPSAFHKALNLKTKLEEKGHAPAHFRVSLVNLWSKGFHHDAVSQYSFVKDKLQDLAVAQENLNRNIDSKAQLDIFMTTANDVRTQFKKS
Ga0302114_1020584923300031621MarineMNIELYTFAKTLKPSAFHKALEIRTQLENESNPPKHFRVSLSNLWSKGFKHDAVAKYNFVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANDVKGGFKKRYGEKEWEP
Ga0307384_1063780423300031738MarineMNIELYTFSKSLKPSSFHKALNIKTKLEEKGHPPDHFRVSLANLWSKGFKHDAVSQYGFVKDKLQDLHVAEQNLNRNIDSHA
Ga0307389_1089094123300031750MarineMKEDMNIELFTFSKTLKPSSLHKAIDLKEKLEAKGHAPAHFRVAVRNLWSKGFKHDAVSNYAFVKEKLQDIDVAEKNLNRNIDSKAQQEIFLKTANEVKKDFNKRYGET
Ga0314670_1047233723300032470SeawaterMNIELYTFAKTLKPSAMHKALEIKEQLEKKNQPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWEP
Ga0314675_1042242213300032491SeawaterMNIELYTFAKTLKPSAMHKALEIKEQLEKKNQPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDKEWEP
Ga0314677_1058542523300032522SeawaterMNIELYTFAKTLKPSAMHKALEIKEQLEKKNQPPAHFRVSLANLWSKGFKHEAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKK
Ga0314683_1083848223300032617SeawaterMNIELYTFAKTLKPSAMHKALEIKEQLEKKNQPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYGDK
Ga0314673_1056425013300032650SeawaterMNIELYTFAKTLKPSAMHKALEIKEQLEKKNQPPAHFRVSLANLWSKGFKHDAVSKYNYVKEKLEDLNVAEKNLNRNIDSKAQLDLFLQVANEVKTGFKKRYG
Ga0314678_1048799813300032666SeawaterMNIELYTFAKTLKPSAIHKALSIKQKLEDSGHPPAHFRVAAHNLWSRGFKHENVANYKYVQDKLQDLDVAEKNLNRNIDSKPQLDMFLKTAQDVKDSFE
Ga0307390_1068757923300033572MarineMNIELLTFSKNLDVKNLRNAIKMKEKLEEGGYTPPHFRASVYSLWEKGFKHEAVKNYKFVKESMEDLLVAEKNLNRNIDSESQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.